Conserved Protein Domain Family
apcD

?
CHL00090: apcD 
allophycocyanin gamma subunit
Statistics
?
PSSM-Id: 164494
View PSSM: CHL00090
Aligned: 6 rows
Threshold Bit Score: 301.7
Threshold Setting Gi: 30468220
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30468220   1 MSVVSQIINQADDELRYPSSGELESLLDYFTTGDRRIRLACLLRDTEKQLISKASQLLFQAHPDYLAPGGNASGAKQRAL 80 
51209850   1 MSLVSQIILNADNELRYPSIGELQSIQNYLKTGEARIGISAKLRNNEKEIIQQAGKAIFQIHPEYIAPGGNAEGPKKRSL 80 
11465661   1 MSLVSQIIINADDELRYPTIGELQSIQNYLITGSNRIRIATIIRDKEKEIIQKASKQIFQLHPEYIAPGGNAAGSRKRSL 80 
11467327   1 MSLVTQILLNADDELRYPTSGELETIKSFLKTGNKRISIINNIAQNEKKIIEQASKQLWQVHPEYISPGGNAYGARQRSL 80 
90994386   1 MSLVTQIIVNADDELRYPTIGELQSIQDYLTTGSNRIRIATIIRDKEKEIIQKASKQIFQLHPEYIAPGGNAAGSRKRSL 80 
11465455   1 MSFVSKTIIEADHELRYLNGAELEILRAYLNSSEKRIKVIKTLRDREKEIISKASRKLFQIHPDYIGPGGNASGSRQRAL 80 
30468220  81 CLRDYGWYLRLITYALIEGDAMVLEKIGLLGVRDMYNSLGVPMIGMYDAIKFLKQAAMqEIPNPQDQALIGVYFDYLAAG 160
51209850  81 CLRDYGWYLRLITYGVLTGDKNSVEKIGVIGVREMYNSLGVPIIGMIDSINCLKRATL-KVLEENEVVIVEPYFDFIIQG 159
11465661  81 CLRDYGWYLRLITYGVLAGDKDSIETIGIIGVREMYNSLGVPIIGMLDAIQCLKEASL-EMLGQDDAKIISPYFDYIIRG 159
11467327  81 CLRDYGWYLRLVTYGILAGDQRPIEKIGIIGVREMYNSLGVPVIGMVDSITALKNSTL-SVLSPEDSEEVKPYFDYIIQA 159
90994386  81 CLRDYGWYLRLITYGVLAGDKDSIETIGIIGVREMYNSLGVPIIGMLDAIQCLKEASL-EMLGQDDIRIISPYFDYIIRG 159
11465455  81 CLRDYGWYLRLITYSIIAGDKNPVERIGLLGVRDMYNSLGVPLIGMVDSIQCLKDAALaELKSEEEVKLAEPYFDFVIQN 160
30468220 161 MV 162
51209850 160 MS 161
11465661 160 MS 161
11467327 160 MA 161
90994386 160 MS 161
11465455 161 MA 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap