Conserved Protein Domain Family
apcF

?
CHL00089: apcF 
allophycocyanin beta 18 subunit
Statistics
?
PSSM-Id: 100206
View PSSM: CHL00089
Aligned: 6 rows
Threshold Bit Score: 251.639
Threshold Setting Gi: 11465540
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467419   1 MKDAITSLIATYDVTGKYFDDNAVDTLNAYFSTASARIESVKIINANVSTIIKTAASALFDEQPELIAPGGNANTTRRYA 80 
90994407   1 MQDAITAILNRYDLTGRYLDKTAVGQLESFFSSGLDRIKIAEIINDQATNILKEAAAQLYEEQPELLRPGGNSYTTRRYA 80 
11465540   3 LQDSIVNIISTYDNAGKYLDSNAITNIKKYFDTADTRLGIVKIINANSSLIIQQASSQLFERNPELIRPSGNAYTTRRYA 82 
30468084   1 MQDQISKIIRRYDFAGQYLDTKAINKVASYFQNAMERLQVVQVLQQDAVDIIKEASNALFTSQPELLRPSGNAYTTRRYA 80 
51210015   1 MQDAITTILNRYDLTGKYLDNIAIEELNNYFISASNRIKVIEIINCQASKIIKEAAARLYEEQPELLRPGGNSYTTRRYA 80 
11465681   1 MQDAITAILNRYDLTGRYLDKAAVTQLESFFSSGLDRIKIAEIINNQATNILKEASAQLYEEQPELLRPGGNSYTTRRYA 80 
11467419  81 ACLRDIDYYLRYATYAIISADVDVLDERVLDGLKETYNSLGVSIAPTVRAIELLKNTSKELIKAAGISAVDFIDEPFDYM 160
90994407  81 ACLRDIEYYLRYASYALVSGSTNILDQRVLNGLKDTYNSLSVPVAPTVRSIQLLQEIIEEELDLQSIKRTDIIQEPFQHL 160
11465540  83 ACLRDIDYYLRYASYSIVANDTSVLSSRVLAGLKDTYNSLGVPLASIVTLLELLKELIKEKTKNIN-DAHKYIDEPFLYM 161
30468084  81 ACLRDLEYYLRYAIYAILAGDMSILNERVLTGLADTYNSLGVPIGPTIIGINQLKEAAKKRINS------PYIDEVFDHM 154
51210015  81 ACLRDIEYYLRYVSYAIVAADTNILKERVLDGLRDVYNSLNVPIAPTIRSINLLQEVTEEEIKSQNIDVINWIVEPFQYI 160
11465681  81 ACLRDIEYYLRYTSYALIAGNTNILDQRVLNGLKDTYNSLSVPLAPTVRSIQLLQEIIEEELELQSITRKDIVQEPFQHL 160
11467419 161 GKVLADSSL 169
90994407 161 INALSEQDL 169
11465540 162 MKILCENDV 170
30468084 155 IKNLC---- 159
51210015 161 IKNLSEEDI 169
11465681 161 INALSEQDL 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap