Conserved Protein Domain Family
apcB

?
CHL00088: apcB 
allophycocyanin beta subunit
Statistics
?
PSSM-Id: 164493
View PSSM: CHL00088
Aligned: 6 rows
Threshold Bit Score: 302.292
Threshold Setting Gi: 30468178
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994452   1 MQDAITSVINAADVQGKYLDDSSVEKLRGYFQTGELRVRAAATIAANAATIIKESVAKSLLYSDITRPGGNMYTTRRYAA 80 
11465727   1 MQDAITSVINAADVQGKYLDDSSVEKLRGYFQTGELRVRAAATIAANAATIIKESVAKSLLYSDITRPGGNMYTTRRYAA 80 
51209970   1 MQDAITSVINAADVQGRYLDDNSLDKLRGYFQTGELRVRASATIAANAATIIKDSVAKALLYSDITRPGGNMYTTRRYAA 80 
30468178   1 MQDAITSVINAADVQGKYLDNNSVEKLRSYFQTGELRVRAAASIAANAAGIIKEAVAKSLLYSDITRPGGNMYTTRRYAA 80 
11467301   1 MQDAITAVINAADVQGKYLDTASVEKLKSYFQTGELRVRAAATIAANSSAIIKEAVAKSLLYSDITRPGGNMYTTRRYAA 80 
11465418   1 MQDAITAVINAADVQGKYLDNNSIEKLRSYFQTGELRVRAAASISANAAGIIKEAVAKSLLYSDITRPGGNMYTTRRYAA 80 
90994452  81 CIRDLDYYLRYATYGMLAGDPSILEERVLNGLKETYNSLGVPIGATIQAILAMKEVTISLVGPDAGKEMGLYFDYICSGL 160
11465727  81 CIRDLDYYLRYATYGMLAGDPSILEERVLNGLKETYNSLGVPIGATIQAILAMKEVTISLVGPDAGKEMGLYFDYICSGL 160
51209970  81 CIRDLDYYLRYSTYGMLAGDPSILDERVLNGLKETYNSLGVPIGATIQAVQAMKEVTSSLVGPDAGKEMGVYFDYICSGL 160
30468178  81 CIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIGATIQSIQAMKEVTASLVGADAGSEMGVYFDYICAGL 160
11467301  81 CIRDLDYYVRYATYAMLAGDTSILDERVLNGLKETYNSLGVPVGATIQAIQAAKEVTAGLVGPDAGREMGIYYDYISSGL 160
11465418  81 CIRDLDYYLRYATYSMLAGDPSILDERVLNGLKETYNSLGVPIGATIQSIQAMKEVTASLVGPDAGQEMGVYFDYICSGL 160
90994452 161 S 161
11465727 161 S 161
51209970 161 S 161
30468178 161 A 161
11467301 161 G 161
11465418 161 S 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap