Conserved Protein Domain Family
apcA

?
CHL00086: apcA 
allophycocyanin alpha subunit
Statistics
?
PSSM-Id: 164492
View PSSM: CHL00086
Aligned: 6 rows
Threshold Bit Score: 331.568
Threshold Setting Gi: 11467302
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465728   1 MSIVTKSIVNADAEARYLSPGELDRIKSFVLSGQRRLRIAQILTDNRERIVKQGGQQLFQKRPDVVSPGGNAYGEEMTAT 80 
90994453   1 MSIVTKSIVNADAEARYLSPGELDRIKSFVLSGQRRLRIAQILTDNRERIVKQGGQQLFQKRPDVVSPGGNAYGEEMTAT 80 
11467302   1 MSIVTKSIVNADAEARYLSPGELDRIKSFAASGERRLRIAQILTDNRERIVREAGQQLFQKRPDIVSPGGNAYGEEMTAT 80 
30468177   1 MSIVTKSIVNADAEARYLSPGELDRIKSFVVSGQRRLRIAQILTDNRERIVKQTGQQLFQKRPDIVSPGGNAYGEEMTAT 80 
11465417   1 MSIVTKSIVNADAEARYLSPGELDRIKSFVMSGQRRLRIAQILTDNRERIVKQAGQQLFQKRPDIVSPGGNAYGEEMTAT 80 
51209969   1 MSIITKSIVNADAEARYLSPGELDRIKSFVLSGQRRLRIAQILTDNRELIVKQGGQQLFQKRPDVVSPGGNAYGEEMTAT 80 
11465728  81 CLRDLDYYLRLVTYGIVAGDVTPIEEIGLVGVKEMYNSLGTPISGVAEGVKCMKSVACSLLAGEDSAEAGFYFDYTLGAM 160
90994453  81 CLRDLDYYLRLVTYGIVAGDVTPIEEIGLVGVKEMYNSLGTPISGVAEGVKCMKSVACSLLAGEDSAEAGFYFDYTLGAM 160
11467302  81 CLRDLDYYLRLVTYGVVAGDATPIEEIGLVGVKEMYNSLGTPVAAVAEGVRSAKSVATGLLSGDDAAEAGSYFDYVIAAL 160
30468177  81 CLRDLDYYLRLITYGIVAGDVTPIEEIGLVGVKEMYNSLGTPISAVAEGVRCMKNVVSTLLSGEDVAEANFYFDYTINAM 160
11465417  81 CLRDLDYYLRLITYSVVAGDVIPIEEIGLVGVREMYNSLGTPLSGVAEGIRSMKSVVSGLLAGDDAAEASFYFDYAIGAM 160
51209969  81 CLRDLDYYLRLVTYGIVAGDVTPIEEIGLVGVKEMYNSLGTPISGVAEGVRSMKNVACSLLAGEDSAEAGFYFDYTLGAM 160
11465728 161 Q 161
90994453 161 Q 161
11467302 161 Q 161
30468177 161 Q 161
11465417 161 Q 161
51209969 161 Q 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap