Conserved Protein Domain Family
psbZ

?
CHL00082: psbZ 
photosystem II protein Z
Statistics
?
PSSM-Id: 177021
View PSSM: CHL00082
Aligned: 131 rows
Threshold Bit Score: 52.3301
Threshold Setting Gi: 11465782
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466772   1 MTIAFQLAVFALIVTSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAILNSLIS 62 
11465782   1 MIIAIQLLVLLLITLSTILVVGVPVVLASPGQWEQSKGLIYTGAGLWTGLVIVTSLVNSLVV 62 
90994507   1 MIIAIQLLVLLLIALSTVLVVGVPVVLASPGQWEQSKGLIYTGAGLWTGLVIVTSLVNSLVV 62 
299830519  1 ---MITALTALLVLISLGLVVTVPVALATPGEWEASKGNFNRVFQAWVSLVIVIAAADGIAS 59 
299830313  1 ---MITALTALLVLISLGLVVTVPVALATPGEWEASKGNFNRVFQAWVSLVIVIAAADGIAS 59 
149072050  1 MVAILQLLVSMLILLSFALVVSVPVILVSPGEWEKSKGLVYTGAGLWFGLVIMTAAFNSFVI 62 
51209945   4 MTIIVQLLVFILVIFSTLLVVGIPVTFASPGQWEKSKNLIYTGAGIWTGLVLITGLVNSFIN 65 
118410979  1 ---MITALTALLVLISLGLIVTVPVALATPGEWENSKSDFTKGFQAWVALVLVIAAADGVAS 59 
11467708   1 MVTILQLLVSILILLSFALVVGVPVILVSPGEWERSKNLVYASAGLWFGLVIVTAAFNSFVI 62 
11467539   1 ---MITALVALLVFISLGLVITVPVALATPGEWEASKSTFTRAFQAWVGLVIVIAAADGISS 59 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap