Conserved Protein Domain Family
chlI

?
CHL00081: chlI 
Mg-protoporyphyrin IX chelatase
Statistics
?
PSSM-Id: 177020
View PSSM: CHL00081
Aligned: 38 rows
Threshold Bit Score: 589.262
Threshold Setting Gi: 283794946
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108773392   8 PSEATQEKEARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIDVVANDPFNSDPYDP 87 
71842291    2 VTDIKPQKTERPIFPFTAIIGQEEMKLALILNVIDPRIGGVMIMGDRGTGKSTTIRAVADLLPEIQVVAGDPFNSSPTDF 81 
11465468    5 ADVFDKKDQFNFVFPFTAIVGQEEMKISLLLNVVDPKIGGVMIMGDRGTGKTTTIRALVDILPDILVVKDDPYNSHPHDV 84 
11465860    3 LSIKENKETVRPVFPFTAIVGQEEMKLALMLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPKIEIVKDDLFNSHPSDV 82 
90994585    3 STTKENKETIRPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPKIEVVKDDLFNSHPMDV 82 
11467357    1 -----MKNNNRPIFPFTAIVGQEEMKLALLLNIVDPKIGGVMIMGDRGTGKSTTIRALADLLPEIDIVANDPFNSHPTDI 75 
51210045    7 IIVTILKDKVRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPKIEVVQDDLFNSHPSDY 86 
115443543  10 IDVNCETLKVRQAFPFTALIGQTNMKLALILNVIDPKIGGVMSMGDRGTGKSTIVRSLVDLLPNIQVVSEDPFNSDPIDY 89 
149071982   1 MTANLEKTNDRLVFPFTAIVGQEEMKLALSLNVIDPKIGGVIIMGDRGTGKSTTIRAITDILPKMEVVKDDPFNSHPTDF 80 
11467650    1 MTINITKTKERPVFPFTAIVGQEEMKLALTLNVIDPKIGGVIIMGDRGTGKSTTIRAITDILPEIPIVENDPFNSHPQDF 80 
108773392  88 ELMSTEVREATQNNSELDVVKAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHL 167
71842291   82 ELMGEEAKVAVMQNKDIPLEARKVPMIDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLAKANRGILYVDEVNLLDDHL 161
11465468   85 DLMSSEVQALVLNRMNIETCYTKVPLVDLPLGATEDRVCGSIDIEKALSEGKKSFEPGLLAKANRGLLYVDEINLLDDHL 164
11465860   83 DLMSDENKHALQNGINIDKAYIKVPMVDLPLGATEDRVCGTIDIEKALTEGVKTFEPGLLAKANRGILYVDEVNLLDDHL 162
90994585   83 DLMSDENKKTLQDGVALTTSYINVPMVDLPLGATEDRVCGTIDIEKALTEGIKTFEPGLLAKANRGILYVDEVNLLDDHL 162
11467357   76 ELMSDNVRQLKENGEEISLIQKKVPMIDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAQANRGILYVDEVNLLDDHL 155
51210045   87 DLMSDSVKSQIESSNHLPTRFIDVPMVDLPLGATEDRVCGTIDIEKALSEGVKTFEPGLLAKANRGILYVDEVNLLDDHL 166
115443543  90 DLMSQEVKEAKKSGEKIYTTSIKTPMVDLPLGATEDRVCGTIDIEKALIDGTKAFEPGLLAKANRGILYVDEVNLLDDHL 169
149071982  81 DLMSEDIRNKVENGETIETIQKKVSMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHL 160
11467650   81 DLMSDEVRSRIEKGESIPSVMKKVSMIDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHL 160
108773392 168 VDVLLDSAASGWNTVEREGISISHPARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRALFDEEPVS 247
71842291  162 VDILLDSAASGWNTVEREGISIKHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVRDPELRVQVVEQRSNFDQDPEA 241
11465468  165 VDVLLDCSASGWNLVEREGISVKHPSKFVLIGSGNPEEGELRPQLLDRFGLHAEIKTVKDPELRVKIVEERTEFDKDPVA 244
11465860  163 VDILLDSAASGWNTVEREGISVRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPELRVQIVEQRTNFDQDPKK 242
90994585  163 VDILLDSAASGWNTVEREGISVRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPELRVKIVEQRTNFDQNPRR 242
11467357  156 VDILLDSAASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPTLRVQIVEERSEFDRSPED 235
51210045  167 VDILLDAAASGWNTVEREGISVRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPSLRVQIVEQRSKFDSDPYI 246
115443543 170 VDILLDSAAGGWNTVEREGISIVHPARFILIGSGNPEEGELRPQLLDRFGMHVRIKTIKDPLSRVKIVERRSNFDKSAES 249
149071982 161 VDILLDSAASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHSEIRTVRDPELRVQIVEQRSAFDRNPQE 240
11467650  161 VDILLDSAASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHSEIRTVRDPELRVKIVEQRSEFDKNPSA 240
108773392 248 FRNNYDQSQQALTDKIVAARNLLKDVQLDYDYRVKISQICSELNVDGLRGDIVTNRAALAICAFEGRTEVTPQDIYRVIP 327
71842291  242 CLSENAEQQQELRDNIVAAQELVSSVKLDYSLRVKISQVCGELDVDGLRGDIVTNRAAKAYAAYNKRTEVTVDDIEAVIT 321
11465468  245 YIRKFSKSQDELREKIINAQNLLPKVEMPRELKFNISKICGILDIDGLRGDIVTNRASKAYAAIQQRNVVEIGDIQKVIV 324
11465860  243 CIENCAKDQIKLKQQIADAQLLLSTITIDYDLRVKISQVCGELDVDGLRGDIVTNRAAKAYAAFNGQQTVNSSDISKVIT 322
90994585  243 CIEDCQKTQNDLKEKIAEAQLLLSNITIDYDLRIKISQVCGELDVDGLRGDIVTNRAAKAYAAFNGQQNVKSSDIGKVIT 322
11467357  236 FLQEYKLQQEVLRQRIINAQQQLNNVQLNYEIKVKISQVCSELDVDGLRGDIVTNRAAKALAAFEGRDEVTVDDVLRIIT 315
51210045  247 CLEEFRDKQDELKLSIIAAQKRLPDVKIDYDLRVKISEVCGTLDVDGLRGDIVTNRAAKAFAAYKNKTKVEINDIKTVIT 326
115443543 250 FLKNYEYLQDFLKNRIVNAQGSLKDIKIDYQYKVNIAELCSNLNIDGLRGDIVTNRAVKAFVALNSRKTVLDKDVFTIMS 329
149071982 241 CLKEYHAGQEEFKERIVKAQEMLPNVSLDYDLRVKISQVCGELDVDGLRGDIVTNRAAKAYAAYNNKTEVTVEDIQAVIT 320
11467650  241 CLETYKNQQTEFKQRIIQAQKVLPTVELDYDLRIRISKICGELDVDGLRGDIVTNRAAKAHAAFNGKQTVTVDDIKAVIT 320
108773392 328 LCLRHRLRKDPLESIDSGDKVRDIFKEVFS 357
71842291  322 SCLRHRLRKDPLESIDSGDKVNKVFEEIFR 351
11465468  325 SCLRHRLRKDPLEIIESGEKIQKAFTNIF- 353
11465860  323 LCLRHRLRKDPLESMDSGEKVEKVFNKVFN 352
90994585  323 LCLRHRLRKDPLEAMDSGEKVQKVFNKIFE 352
11467357  316 LCLRHRLRKDPLEEIDSGQKVEKVFQRIFS 345
51210045  327 LCLRHRLRKDPLETIDSGYKVQQVVNSILN 356
115443543 330 LCLTHRLKKNPLESIDSSQNIVTIFKDIFG 359
149071982 321 MCLRHRLRKDPLETIDSGDKVQKVFDAVFN 350
11467650  321 MCLRHRLRKDPLETIDSGSKVQKVFEDIFA 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap