Conserved Protein Domain Family
psbM

?
CHL00080: psbM 
photosystem II protein M
Statistics
?
PSSM-Id: 177019
View PSSM: CHL00080
Aligned: 116 rows
Threshold Bit Score: 36.6794
Threshold Setting Gi: 222084195
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466775   1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34 
29565589   1 MEVNNLGFIAVLMFLAIPTAFLLIPYVKTASASS 34 
237688590  1 MEVNNLGFIAVLMFLAIPTAFLLIPYVKTASASS 34 
237688658  1 MEVNNLGFIAVLMFLAIPTAFLLIPYVKTASASS 34 
22711945   1 MEVNILAVIATALFVLIPTAFLLILYVKTESAGS 34 
7524622    1 MEVNTLAFIAVLLFLAVPTAFLLIPYVKTASASS 34 
237688521  1 MEVNNLAFIAVLLFLAVPTAFLLIPYVKTASASS 34 
237688458  1 MEVNTLAFIAVLLFLAISTAFLFIPYVKTASASS 34 
260780649  1 MEVNILGLIATTLFIIIPTSFLLILYVKTASQN- 33 
153805606  1 MEVNILGLIATTLFILIPTSFLLILYVKTASQEE 34 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap