Conserved Protein Domain Family
rpl21

?
CHL00075: rpl21 
ribosomal protein L21
Statistics
?
PSSM-Id: 177014
View PSSM: CHL00075
Aligned: 38 rows
Threshold Bit Score: 120.361
Threshold Setting Gi: 269101058
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270267289   2 GTYAIIETGGEQLRVEPGRFYDARCFAslnpriLSANAKILIHRVLMIRRESTTNLGHPWLRN---AIVRGRILHSCYGE 78 
11467628    1 MKYAIIEASGKQFWVEPGRFYDFNSLN------VEPGDKIALTRVLLINDNGNITVGKPCLDN---VKVEATVLGHLRGQ 71 
149071975   1 MNYAIIEASGRQFWVEPGRFYDFNHLD------LNPGDKIALRRVLLINKDGNVTVGQPCLEN---AKIEATVLGHIKSK 71 
242620105   1 MKYAVIEIGGKQLLVEEGKYYATNRLP------HKAGSSLSLQRILLCNDKGRRLVGHPYIENlesVEIKATVLEHFKDS 74 
90994400    1 MTYAIIEASGTQLWIEEGRYYDLNHIP------VDPGQSIILGKVLLLNKNGEVTLGRPCIEG---VTIKATVMRHLRGK 71 
269101058   1 MEYAIIEASGRQFWVEPKKFIEFNRLI------LKIGSTILIKRILFAKNKTTTHIGQPYLQN---ILVKGKISKHFLGP 71 
269100998   1 MEYAIIEASGRQFWVEPKKFIEFNRLI------LKIGSTILIKRILFAKNKTTTHIGQPYLQN---ILVKGKISKHFLGP 71 
242624325   1 MKYAVIEIGGKQIVVEEGKYYSVNRLP------QKIGSSLSLSRILLCNDHGHRVLGYPYIENsekVKVFATVLEHFNMP 74 
215400827   1 MIYGIIEASSRQYWIEPGKIIDINNLP------IKSGSTILLNQILFARNQDQIFIGRPYLNK---ITVKATIEKHFLGP 71 
189095392   1 MEYAIIEASGRQFWIEPRKYYTMNHVP------LKRGTKVILNNILLVNQNDEMQLGFPYLNN---VKIEGIILNHFDGQ 71 
270267289  79 KITIYKMHSKKKVRRKLGYRQKLVRFVVDSISSNGE 114
11467628   72 KVTVYKMQPKKKTRKKQGHRTNLTRLLIDNIIN--- 104
149071975  72 KITVYKMRPKKKTRKKQGHRDNLTRILIDNITLG-- 105
242620105  75 KITVFKMKPKKKTRWTKGHRQAQTRIMIDKIETKPN 110
90994400   72 KITVFKMKPKKKMRLKKGHRQELTRLMIDSITS--- 104
269101058  72 KILVFKMKPKKKYRKKIGHRQKMTRLLIHKIE---- 103
269100998  72 KILVFKMKPKKKYRKKIGHRQKMTRLLIHKIE---- 103
242624325  75 KITVFKMKPKKKLRWTRGHRQAQTRIMIDKIETKS- 109
215400827  72 KIIVYKMKPKKKYKRKNGHRQHLTRLMIQKINF--- 104
189095392  72 KVLVYKMKPKKKYKRKNGHRQKLTKLYIDKISL--- 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap