Conserved Protein Domain Family
chlL

?
CHL00072: chlL 
photochlorophyllide reductase subunit L
Statistics
?
PSSM-Id: 177011
View PSSM: CHL00072
Aligned: 52 rows
Threshold Bit Score: 484.24
Threshold Setting Gi: 224179408
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224179408  20 LKLATYGKGGIGKSMVSCNLSVGLAQRGRKVLQIGCDPKHDSTFTLCGFMIPTIIDTLQKKDFVYSNVWSEDIIYKGLFN 99 
11467428    1 MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGHLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAG 80 
269101111   1 MKLAVYGKGGIGKSTTSCNISVALCRRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDIWPEDVIYQGFGG 80 
11465653    1 MKLAVYGKGGIGKSTTSCNISVALSKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYKGYGG 80 
242624321   1 MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPEDVIYKGFGN 80 
108773311   1 MKLAVYGKGGIGKSTVSCNLSIALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPEDVIYAGYGG 80 
301500992   1 MKLAVYGKGGIGKSTTSCNISVALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIHRGYGG 80 
215400786   1 MKLAVYGKGGIGKSTTSCNISVALSRRGKKILQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYKGYGA 80 
301501001   1 MKLAVYGKGGIGKSTTSCNISVALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIHRGYGG 80 
41179011    1 MKLAVYGKGGIGKSTTSCNISIALRKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLSSKDYHYEDIWPEDVIYGGYGG 80 
224179408 100 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYSYDVIIFDVLGDIVCGGFAAPLNYSDYCLITTDDSFDSLFAANRIF 179
11467428   81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGFASPLNYADYCLIVTDNGFDALFAANRIA 160
269101111  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIA 160
11465653   81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGFAAPLNYADYCLIITDNGFDALFAANRIA 160
242624321  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIA 160
108773311  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIV 160
301500992  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIV 160
215400786  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIA 160
301501001  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIV 160
41179011   81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFFEYDVILFDVLGDVVCGGFAAPLNYADYCIIVTDNGFDALFAANRIA 160
224179408 180 ASIREKARTHPLRLVGVVVNRTLNRDLVMRFAKTSPFAILEALPLLETIKESRILGKPLIYMRKRLedalenkieqeeev 259
11467428  161 ASVREKARTHQLRLAGLIGNRTTKSDLIEKYTENVPIPILQLLPLIEDIRISRVKGKTLFEMSESN-------------- 226
269101111 161 ASVREKARTHALRLAGLIGNRTATRDLIDKYIDAVPMPVLEVLPLIEDIRVSRVKGKTLFEMTEFD-------------- 226
11465653  161 ASVREKARTHSLRLAGLVGNRTDKRDLIDKYIDCVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESD-------------- 226
242624321 161 ASVREKARTHSLHLAGLIGNRTSTRDLIDKYIKHVPMPVLEVLPLIEDIRVSRVKGKTLFEMAETN-------------- 226
108773311 161 ASVREKARTHPLRLAGLIGNRTATRELIDKYVEVCRMPVLEVLPLIEEIRISRVKGKTIFELEELE-------------- 226
301500992 161 ASVREKARTHALRLAGLIGNRTAKRDLIDKYLETVPVPVLEVLPLIEDIRISRVKGKTIFEICEQE-------------- 226
215400786 161 ASVREKARTHTLRLAGLIGNRTSTRDLINKYIDTVPMPVLEVLPLIEDIRVSRVKGKTLFEMAEFD-------------- 226
301501001 161 ASVREKARTHALRLAGLIGNRTAKRDLIDKYLETVPVPVLEVLPLIEDIRISRVKGKTIFEICEQE-------------- 226
41179011  161 ASVREKARTHPLRLAGLIGNRTSKRDLIDKYVEACPMPVLEVLPLIEEIRISRVKGKTLFEMSNKNnmtsahmdgskgdn 240
224179408 260 tieeqrefDLMTYTCGAFLSLADVFSTNPEGVVPMELPDRTIFTLLSTGVSTSP----------------LEREAAMa-- 321
11467428  227 --------PELSPICDYYLNIADQILAKPEGIIPNEVLDRDLFTLLSDFYLNMD-------------------------- 272
269101111 227 --------SSLCYICDYYLNIADQLIANPEGVVPKEAADRELFSLLSDFYLNPT----------------QKETENNv-- 280
11465653  227 --------TNLAYVCDYYLNIADQLIARPEGVVPKEAADRELFSLLSDFYLNPK----------------SNTTKSTa-- 280
242624321 227 --------PDLNQVCDYYLNIADQIIAQPEGVIPEEASDRELFSLLSDFYLNPV---------------------ENk-- 275
108773311 227 --------PNLKSIGEYYLNIADQLLAQPEGIVPQELADRDLFTLLSSFYLSDQqtekayssiqhvhgsvGEGCSAQnse 298
301500992 227 --------PALVSVCGYYLNIADQLLAQPEGVVPREAADRDLFSLLSDFYLAPS----------------SVSRP----- 277
215400786 227 --------NSLEYVCDYYLNIADQLIANPEGVIPKEAADRELFSLLSDFYLNPT----------------TENQKINd-- 280
301501001 227 --------PALVSVCGYYLNIADQLLAQPEGVVPREAADRDLFSLLSDFYLAPS----------------SVSRP----- 277
41179011  241 stvgvsetPSEDYICNFYLNIADQLLTEPEGVIPRELADKELFTLLSDFYLKI--------------------------- 293
224179408 322 ---KIQESEFAMV 331
11467428  273 ---SSESSNLTLV 282
269101111 281 ---FEDAFDEIG- 289
11465653  281 ---DEEELDLMMV 290
242624321 276 ---VSDSLELITY 285
108773311 299 qnqTANDYSFEFI 311
301500992     -------------    
215400786 281 ---FSLLEEIIQN 290
301501001     -------------    
41179011      -------------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap