Conserved Protein Domain Family
tufA

?
CHL00071: tufA 
elongation factor Tu
Statistics
?
PSSM-Id: 177010
View PSSM: CHL00071
Aligned: 52 rows
Threshold Bit Score: 697.091
Threshold Setting Gi: 71025965
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194033323   1 MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMALAVR-GGAKAKKYDEIDSAPEEKARGITINAAHVEYETENRHYAH 79 
209892884   1 MAKEQYIKNKPHINIGTIGHIDHGKTTLTSALTSVLKAKgLAKKAHSYEEIDSAPEEKSRGITINTKHVEYESNYRHYAH 80 
11496548    1 MAKEIFKKQKPHINIGTIGHVDHGKTTLTAAITYVLAKN-NQAKLKTYKEIDCAPEEIARGITIKTSHIEYETAVRHYAH 79 
31442379    1 MAKKFFEKTKTHLNIGTIGHVDHGKTTLTAAITSYLSKI-NNTKAKSYSEIDSAPEEKARGITINTSHIEYETNLRHYAH 79 
301500877   1 MAREVFDRSKPHLNIGTIGHVDHGKTTLTAAIATILSRG-TKNAARSYAEIDSAPEEKARGITINTAHVEYETELRHYAH 79 
301500981   1 MAREIFERGKPHVNVGTIGHVDHGKTTLTAAITSVLAVT-SGGKAKKYDEIDAAPEEKARGITINSAHVEYETSKRHYAH 79 
71025965    1 MSKEQFLRNKPHVNIGTIGHVDHGKTTLTSAITSVLKLKgCTEKSYSYEDIDSTKEEKKRGITINTTHVEYESDLRHYAH 80 
11467350    1 MARQKFDGNKPHVNIGTIGHVDHGKTTLTAAITTALASQ-GKGKARKYDEIDAAPEEKARGITINTAHVEYETEKRHYAH 79 
108773418   1 MAREKFERIKPHINIGTIGHVDHGKTTLTAAITMALASI-GNTKGKNYADIDSAPEEKARGITINTTHVEYETAKRHYAH 79 
108773269   1 MAQEVFQRTKPHVNIGTIGHVDHGKTTLTAAITMTLAVN-STCTPKKYDEIDAAPEERARGITINTAHVEYETASRHYAH 79 
194033323  80 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHVLLAKQVGVPAIVVFLNKEDQVDDADLIELVELEVREILD 159
209892884  81 IDCPGHADYIKNMITGAVQMDGAVLVISLTDGPMPQTIEHLLLIKQIGIENVIVFLNKEDKITDIELSNFVEEEVRDILL 160
11496548   80 IDCPGHADYIKNMITGAAQMDGAILVVSAVDGPMPQTKEHLLLAKQIGISNIIVFLNKIDLIDDNEILELVELETRELLD 159
31442379   80 IDCPGHADYIKNMITGAAQMDGAILVVSATDGPMPQTREHLLLAKQVGVPNIIVFLNKIDMVEDNELLELVELEVRELLD 159
301500877  80 VDCPGHADYIKNMITGAAQMDGAILVVAATDGIMPQTTEHLLLARQVNVPYIVCFLNKEDLLDDPELLEIVEAELQEELE 159
301500981  80 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLSRQVGVPNIVVFLNKEDQVDDPELLELVELEVREMLS 159
71025965   81 IDCPGHADYIKNMIIGAVQMDGAILVISLEDGPMPQTIEHLLLAKQIGIKKLVVFLNKEDKVDDEEIIFFIKEETKSMLD 160
11467350   80 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLAKQVGVPNMVVFLNKEDQIDDADLLELVELEVRELLS 159
108773418  80 VDCPGHADYIKNMITGAAQMDGAILVVSGADGPMPQTREHIVLAKQVGVPSMVVFINKEGQVDDPEILELVELEVRDLLT 159
108773269  80 VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTKEHILLAKQVGVPSIVVFLNKEDQVDDEEILQLVDLEVRESLI 159
194033323 160 KYGFASAEIPVIKGSALLALEALVENPSIKQGENPWVDKIYHLMDTVDEAIPTPERETDKPFLLAIEDVFSITGRGTVAT 239
209892884 161 KYNFKEEFVHFTSGSALEALNVVKQSSKLDFNNK-WIKKILNLVDCIDKYIPTPTRDLLKPFLMPVEDSFSITGRGIVAT 239
11496548  160 KYNFSSD-TPIITGSALKALDNNLTSNI-------WVDKIYELLTALDSYIPLPKRDLDKPFLLAIEDIFSITGRGTVVT 231
31442379  160 IYEYNGDSTSIIKGSALKALEYIEKNDLNNK----WVKNLKNLIEALDKSIPEPKRDINKPFLLSIEDIFSITGRGTVVT 235
301500877 160 KYQFSTD-VPFVSGSALKALEYVVANPNWEPGDNKWVDRIIQLMNVVDEYIKTPERDVTKPLLLSIESACSVTGRGTVVT 238
301500981 160 SYGFPGDDIPCISGSALQALETVQKNPGIKRGDNDWVDKILALMDAVDDYIPTPEREVDKPFLMAVEDVFSITGRGTVAT 239
71025965  161 KYGFDSTLTPLITGSALKALEEIKLLKEIDLNNK-WISKVINLIDTVDSYIEKPERNLNKPFLMPIEDSFYITGRGTVVT 239
11467350  160 KYDFPGDQIPFVSGSALLALESLSSNPKLMRGEDKWVDKILALMDAVDEYIPTPERPIDKSFLMAIEDVFSITGRGTVAT 239
108773418 160 SYKFEGEEVPVITGSALLALEAFIKNPKILKGENPWVDKIYNLMDSVDSYIPTPVREIDKPFLMAIEDVFSISGRGTVAT 239
108773269 160 NYEFPGDKVPVVAGSALMALQALTEKPNTLRGENKWVDKIYELMDAVDSYIPTPKRDIEKPFLMPIEDVFSIQGRGTVAT 239
194033323 240 GRVERGKLKIGDSVELVGLGET-RNTTVTGIEMFQKILDEALAGDNVGVLLRGVQKKDIARGMVLAQPGTITPHTKFEGQ 318
209892884 240 GKVERGSANIGDKVELLGYDSS-KIVSILNIEMFNKSLLKAESGDNVGILLRGVTKEDIKRGYVLTVPGSSKLYKQFKAN 318
11496548  232 GKIERGSIKLGDTVTMLGFNIS-KNVVVIGLEMFQKTLEIGEAGDNVGILLRGIQKTEVKRGMILSKPLTMTLHSIFQAD 310
31442379  236 GKIERGKVKLNDTVDILGFNLL-KTTTVTGIEMFQKILNTAEAGDNVGILLRGIQKNEVRRGMVLAKPLSILTYSKFDAE 314
301500877 239 GKIDRGRVVTGQTVNLLGFDKK-KSVTITGLEMFRKTLFEALAGDDVGALLRGVQLKEVKRGMVLASPKTLFSSATFIGS 317
301500981 240 GRVERGKVKVGETIEIVGLKPT-RSSTVTGIEMFQKTLEEGVAGDNIGVLLRGIQKTDILRGMVLAAPGSITPHTEFQAE 318
71025965  240 GRIENGIVKLNDKVELYGYDKS-KLTSVIGIEMFNKGLSQGESGDNVGLLLRGIIKEDVKRGHVVAKPKSLKFYSEFKAT 318
11467350  240 GRIERGAIKVGETVELVGLKDT-KSTTVTGLEMFQKTLEEGMAGDNIGILLRGVQKTDIERGMVLAKPGSITPHTQFESE 318
108773418 240 GRIERGKIKMGDSIEIIGGSLR-KTTTVTGIEMFQKTLTDGVAGDNVGILMRGIQKKEIERGMVLTKPKSIDPLTSFEAQ 318
108773269 240 GRIERGILKLGDIVELIGLNEKiRSTVVTGLEMFRRLLEQGFAGENIGVLLRGIEKKDIERGMVIAQPGTIEPHTRFEAQ 319
194033323 319 VYILTPEEGGRKTGFFKGYQPQFYVRTTDVTGTIV---SFNyikqlnssELsMMHSNPMICPGDYVNMLVELKTPIAIEK 395
209892884 319 LYVLSKLEGGRHTAFTVGYKPQFFIRTANITGTIT---NIY--------SSsNDLSLDLAIPGDNVIVTADIEKSMPLET 387
11496548  311 VYILTVAEGGREKPIFEGYCPQFYLYTINITGSIK---FSS--------ET-KETGTKMILPGDRVKLNVTLIYSIAMEK 378
31442379  315 VYILSSSEGGRKKPFFEGYKPQFYFYTTDVTGTIE---FLR-----------NPEKPEMILPGDKVKLRISLMYSIALEK 380
301500877 318 VLIISTTDGGRSKPFNVGYKPQFYLRTADCTGRVRgiySYVssdgksapLD-NSNFKKFALPGSSYYLFIEFATKMPLEV 396
301500981 319 VYILTPDEGGRHKPFFAGYRPQFYVRTTDVTGSIT---AIKnv-----sEDgTEEDISMVMPGDKVTIEASLIYPIAVEE 390
71025965  319 LYILTSKEGGRTNPFKIGYKPQFFIRTLDITGEIKk--LYS--------TTnENNTLELAIPGDNINANISLSKSIVLEK 388
11467350  319 VYVLTKDEGGRHTPFFSGYRPQFYVRTTDVTGSID---AFT--------AD-DGSNAEMVMPGDRIKMTVSLVHPIAIEQ 386
108773418 319 VYLLTKEEGGRSKGFTIGYRPQFYVRTTDVTGAIL---NML--------SD-DNTPLKIASPGDRITMSVKLIQPIALEK 386
108773269 320 VYILRKEEGGRHSPFFAGYRPQFFVRTADVTGVIE---AFE--------YD-NGDKTRMVMPGDRVKMIVNLICPIAIEK 387
194033323 396 SMRFAIREGGRTVGAGTVNTIVE 418
209892884 388 ELRFAIREGGKTIGAGIVIELLK 410
11496548  379 GMRFAIREGGRTIGAGIITDIIK 401
31442379  381 GMRFAIREGGKTIGAGIIIDLIN 403
301500877 397 GLQFAIREGGITVGAGQIVQVAF 419
301500981 391 GMRFAIREGGRTVGAGLVVKIVK 413
71025965  389 ELRFSVREGGKTIGHGIIIDLIK 411
11467350  387 GMRFAIREGGRTIGAGVVSKILK 409
108773418 387 NMRFAIREGGKTVGAGVVSKLIN 409
108773269 388 KMRFAIREGGRTIGAGVVLQILD 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap