Conserved Protein Domain Family
petB

?
CHL00070: petB 
cytochrome b6
Statistics
?
PSSM-Id: 177009
View PSSM: CHL00070
Aligned: 175 rows
Threshold Bit Score: 381.761
Threshold Setting Gi: 301500917
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466819    1 MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEANFGW 80 
113170423   1 MSKVYNWFNERLEIQSIADDVTSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEVNFGW 80 
269101103   1 MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCFGGIVFTCFLVQVATGFAMTFYYRPSISEAFSSVEYIMTEVNFGW 80 
226968694   1 MSKVYNWFNERLEIQAIADDVTSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTDVNFGW 80 
242620099   1 MSKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCFGGIVLTCFLVQVATGFAMTFYYRPTVSDAFASVEYIMTEVNFGW 80 
11467615    1 MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCIGGITFTCFIIQVATGFAMTFYYRPTVAEAFASVEYIMTEVNYGW 80 
189095400   1 MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCFGGITLVCFLVQVATGFAMTFYYRPSVSEAFASVEYLMTSVNFGW 80 
149072108   1 MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCLGGITFTCFIIQAATGFAMTFYYRPTVAEAFASIEYLMYEVNYGW 80 
71842221    1 MSSVYDWFQERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFIVQVATGFAMTFYYRPTVTEAFASVEYLMTEVNFGW 80 
242624331   1 MSKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCFGGIVLTCFLVQVATGFAMTFYYRPTVSDAFASVEYIMTEVNFGW 80 
11466819   81 LIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPV 160
113170423  81 LIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVILSVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPV 160
269101103  81 LIRSIHRWSASMMVLMLILHVFRVYLTGGFKKPRELTWVTGVTLAVTTVSFGVTGYSLPWDQVGFWACKIVTGVPEAVPV 160
226968694  81 LIRSVHRWSASMMVLMMVLHVFRVYLTGGFKKPRELTWVTGVILSVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPV 160
242620099  81 LIRSIHRWSASMMVLMLILHVFRVYLTGGFKKPRELTWVTGCLLGVVTASFGVTGYSLPWDQVGFWACKIVTGVPDSIPV 160
11467615   81 LFRSMHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVTLAVVTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPV 160
189095400  81 LIRSIHRWSASMMVMMMILHVFRVYLTGGFKKPRELTWVTGVTLAVVTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAVPV 160
149072108  81 LFRSMHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVTGVTLAVVTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPV 160
71842221   81 LIRSVHRWSASMMVLNMILHVCRVYLTGGFKKPRELTWVTGVLLASVTVSFGVTGYSLPWDQVGYWACKIVTGVPDAVPI 160
242624331  81 LIRSIHRWSASMMVLMLILHVFRVYLTGGFKKPRELTWVTGVLLGVVTASFGVTGYSLPWDQVGFWACKIVTGVPEAIPV 160
11466819  161 IGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL 215
113170423 161 IGGFVVELLRGSVGVGQPTLTRFYSLHTFVLPLLAAVFMLMHFLMIRKQGISGPL 215
269101103 161 IGPPIVQLLRGGVSVGQSTLTRFYSAHTFVLPLVAAALMITHFLMIRKQGISGPL 215
226968694 161 IGSFVVELLRGSVGVGQPTLTRFYSLHTFVLPLLAAVFMLMHFLMIRKQGISGPL 215
242620099 161 VGPLIVGLLRGGVSVGQSTLTRFYSAHTFVLPVAAAALMLTHFLMIRQQGISGPL 215
11467615  161 VGSLLVELLRGSVSVGQATLTRFYSAHTFVLPVAAAVLMLTHFLMIRKQGISGPL 215
189095400 161 IGQPLVELLRGGLSVGQPTLTRFYSLHTFVLPLAAAVLMLTHFLMIRKQGISGPL 215
149072108 161 VGSLLVELLRGSVSVGQATLTRFYSAHTFVLPVAAAVLMLTHFLMIRKQGISGPL 215
71842221  161 VGGLIVQVLRGGVSVGQSTLTRFYSAHTFVLPVVAAVLMLTHFVMIRKQGISGPL 215
242624331 161 VGPTIVGLLRGGVSVGQGTLTRFYSAHTFVLPLVAAVLMLTHFLMIRQQGISGPL 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap