Conserved Protein Domain Family
rps2

?
CHL00067: rps2 
ribosomal protein S2
Statistics
?
PSSM-Id: 177007
View PSSM: CHL00067
Aligned: 168 rows
Threshold Bit Score: 114.176
Threshold Setting Gi: 31442387
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108773057  10 GQQLLKTKD-------FVeknknttvvtlsyeklltlqnstggDNLQVTA----TLPNPSPEIFKKMIAIVSNLrkeENG 78 
153805630  21 FSARNWEEKqvidkklIK-------------------------SMFEAGL----HRGDLTQNWNPKMAPYIRGE---FKG 68 
304322965  51 KGMLFDNTKnri--dtYK-------------------------EMLKRNV----HYGDKTVTCNPEMKKFTRGK---DRG 96 
31442387    1 ----MLNIN-------IL-------------------------DLIKKKIipikYIIKPKNYYRD---NFLYNN---F-N 37 
115443588   4 ELKNFNTIR-------INknqtilikttnlensskedtyqfilKMLKAGV----HFGHKIKKWNPKMSPFIYQK---LQG 69 
11496554    1 ----MILLK-------LN-------------------------SLINIPI----YIGSATSYRQKKFINYIYKK---YNN 37 
115350015  49 KIINFDNFSnpi--etYK-------------------------IMLRKSL----HFGHPVIQCDSGMKKYIRGQ---SNG 94 
194033316  24 RKKMINDLSniiiekiLKfdnnan-------------kielykKMLKRGM----HYGHNIVKCHPEMKRFIKTE---SNN 83 
11467017    1 ------MIT-------VE-------------------------KMLNSSV----HLGHKVKQWNPRMRIYIYGE---RKG 35 
41179034    1 ---MNVYVT-------LK-------------------------TKLVAEL--------------RQIKQTLQTE---RNI 28 
108773057  79 FFATNqmgtssnrakstdtpavstsqnvgganepktiliskflnkfilllpffknslqtlsdrLVQQEKMLKELNSTFTK 158
153805630  69 KHVIN----------------------------------------------------------LVQTLLYLEEVCAFLEK 90 
304322965  97 NSFIS----------------------------------------------------------LFQTRRYLIRALWLLTK 118
31442387   38 KYIIE----------------------------------------------------------LFNLLNSLSIIYLYIYK 59 
115443588  70 IHIID----------------------------------------------------------IIQSYTYLKKACKLVYS 91 
11496554   38 KHFFN----------------------------------------------------------IFIILKYLSKAYLYLYI 59 
115350015  95 KHFIN----------------------------------------------------------LFRTKRYIRKALWYLTK 116
194033316  84 KNLIN----------------------------------------------------------LIQTKYYLKKCLWTLAQ 105
11467017   36 LHIID----------------------------------------------------------LLQTIVCLKKACNFLIR 57 
41179034   29 IRVLR--------------------------------------------------------------------------- 33 
108773057 159 ITESqkslkqlykktisqyavvSSKFIVQQNNFKKfqKNLKQFASEQRLLkFLPKLRYLPTSQTKmYEIVELFMKKFVDP 238
153805630  91 EALK------------------GKKFLFVGTQTHS--SVVVKKTAIRTNS-FFVNEKWLGGMLTN-WKTAKRLVRRLNFL 148
304322965 119 YAYQ------------------KRPMLFVGTSRPS--SRPVATAALNTKS-FFVNVRWLGGMLTN-WKTMRKLIKKLKKF 176
31442387   60 YSSL------------------KQKILLSTDYIQY--IFILKLITSLTSN-YYIYSDIYSGIFSN-WFFLKKKLIIYNWL 117
115443588  92 KSLTd----------------nYNTFLFVGTKKQSpiPNSIFYHASRCNS-FYINNKWLSGMLTN-WENTTRSINTLKYL 153
11496554   60 LSKY------------------NRSLLFLNSSIKN--FNLIKSLANLTNN-FYINFFYKIDFLFN-WIMFKNKLILLKWL 117
115350015 117 YAYK------------------RKNILFVGTAIPS--ARYVATTALKTKS-FFVNFRWLGGMLNN-WKTLRKLLQKLKTL 174
194033316 106 LSYK------------------QKNILFVGTTIPS--SRFIGTAAIKTRS-FFVNIRWLGGMLTN-WKTIKKLIIKLHTL 163
11467017   58 SVRK------------------GKRALFVCTKRFF--SILTQKIALKCNS-FFVTKRWLGGILTN-WITIKNCINKLKQL 115
41179034   34 -----------------------RKLKQIAAQKRF-------------IK-FLPKLRYLPTPVTKiEQTARFLVKKFVDP 76 
108773057 239 KLSYPMEQIYDqkl-kfTSKKIAATRKQKWQ----RLEKYFGGITKMAKMntkqisKNVAIIIGQQEEMNAVHECRKLGM 313
153805630 149 LMLEKTTYIQK------LSKKERNDFKKEKN----KLKKYFLGLRSMQKL------PGVVILASQNQEMNALKECQRLKI 212
304322965 177 TKLRQKKAFLN------SPKKEIAARKKEIQ----RLEKYLKGLKMLRTF------PQVVIMASQKKEKSAALECQKMGI 240
31442387  118 RYFFLTNLIIK------NNYKNIFYIYYTLYliylKLKLKYNNLRNLNTI------PNLLIFIILEKN-KFLKEILKLNK 184
115443588 154 KVYQKTNMFSK------LSMKTHSIIDKKKN----RLEKYFGGIQNMTSL------PSTVILVGQHNEITASKECRKLGI 217
11496554  118 ---KQLYTFYLkylfnyLPYNLLIKLYYIYI----NILKKFGGLEYMQKL------PKNIFICNSYSNYLYKNLNLKN-F 183
115350015 175 QKEQKNKIWKN------LPKKEGIARLKEKQ----RLEKYLKGIQMIKGF------PEVVIMTSQTKDLSAARECKKMGI 238
194033316 164 EKEQKSKIFKN------LPKKQSAARQKERL----RLEKYLKGIALIQKF------PEIIIMTSQKRDISAALECQKLGI 227
11467017  116 -SKQKEKHHNL------LTKKERLVLKKKKL----KLKKYFSGMRDMTER------PEIVIIIGQNKEINAVRECKKLGI 178
41179034   77 KMKYPMDSIYDkkl-srQSKKVAASRKKKWQ----RLEKYLGGISNMTKIkekqiaNNVAIIIGQQEEMNAVRECQKLGI 151
108773057 314 KIFAVVDTNCNPKFV--DHIIPANDDSRNSIKYILGEMLTYIRLGQK 358
153805630 213 PSVTILDTNSDPTLS--DYFIPGNDDSYKSLNFLFKFFRLAIKKGRN 257
304322965 241 FNMTIADTDCNPKLA--DFIIPANDDSSTSIKFLLFYFAKAILIGKL 285
31442387  185 NIIIISNKNLNKNLFknNIKIITDTKNLNIVYIIFKIITTSIYHGIL 231
115443588 218 NNITILDTDCNPEFV--DLFIPANDDSSSSLNLILGELQVAINIGRQ 262
11496554  184 LIISIVDINNENTLKniSVRIIGNNKSYLAIKFIFNILLTALLHGSL 230
115350015 239 WNLSILDTNCDPRLA--DLMVPANDDSASSVKFLLFNFAKAIQAGRA 283
194033316 228 TNFSIIDTDCDPRLA--DYIIPANDDSASSIKFILYYYSKAIRTGLI 272
11467017  179 ASITILDTNCDPTLT--KYPIPSNDDSILSVSLILSVLCNSINRGVN 223
41179034  152 KMFHIVDTNCNPGLA--DHFIPANDDARNSIKFILGKFLTRIRLAHK 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap