Conserved Protein Domain Family
psbH

?
CHL00066: psbH 
photosystem II protein H
Statistics
?
PSSM-Id: 177006
View PSSM: CHL00066
Aligned: 166 rows
Threshold Bit Score: 80.0681
Threshold Setting Gi: 11465791
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466818   1 MATQTVEDSSRPGPRQTRVGNLLKPLNSEYGKVAPGWGTTPFMGVAMALFAVFLSIILEIYNSSVLLDGILMN 73 
60117166   1 MATQISDISRRTKVKSTGLGNALKPLNSEYGKVAPGWGTTPIMGVAMASFAVFSVIILELYNSSVSLDGIPVS 73 
124302935  1 MATKIIDDTPKGKPKTSGLGVFLKPLNSEYGKVAPGWGTTPLMGFFMALFAVFLVIILEIYNSSVLLDGISIS 73 
242910177  1 MATKVIDDTPKGKPRISLLGIILKPLNSEYGKVAPGWGTTPLMGFFMALFAVFLVTILEIYNSSVLLDGIPIS 73 
28202201   1 MATQIIDDTPKTKGRRSGIGNILKPLNSEYGKVAPGWGTTPLMGIAMGLFAVFLVIILELYNSSVLLDGVSVS 73 
18860340   1 MATKIFDDALRAKPKQSGLGVFLKPLNSEYGRVAPGWGTTPLMGFFMALFAIFLVIILEIYNSSVLLDGLSIS 73 
30352061   1 MATKVLDETPKGKPKISFLGMVLKPLNSEYGKVAPGWGTTPLMGFFMALFAIFLVTILEIYNSSVLLDGIAIS 73 
301353402  1 MATKVIDDTPRGKPRISFLGMVLKPLNSEYGKVAPGWGTTPLMGFFMALFAVFLVTILEIYNSSVLLDGLPVS 73 
223931047  1 MATQIIDDTPKTKGKRSGLGDILKPLNSEYGKVAPGWGTTPLMGIAMGLFAVFLVIILELYNSSVLLDGVPVS 73 
169142817  1 MATQIIDDVPETRGKKGGVGDILKPLNSEYGKVAPGWGTTPFMGIAMALFAVSSVTIPELYNSSVLLDGVSIS 73 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap