Conserved Protein Domain Family
psaC

?
CHL00065: psaC 
photosystem I subunit VII
Statistics
?
PSSM-Id: 177005
View PSSM: CHL00065
Aligned: 173 rows
Threshold Bit Score: 93.6723
Threshold Setting Gi: 237688504
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467436   1 MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKSGQIASSPRVEDCVGCKRCETACPTDFLSVRVYLGRlETTRSLGL 80 
29565693   1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
150251535  1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
172072937  1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
222084067  1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
7524738    1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQIASAPRTEDCAGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
237688639  1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQXXXXXXXEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
237688570  1 MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGCKAKQXXXXXXXEDCAXXXXXXXXXXTDFLSVRVYLWH-ETTRSMGL 79 
295136986  1 MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
295136960  1 MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWH-ETTRSMGL 79 
11467436  81 AY 82 
29565693  80 AY 81 
150251535 80 AY 81 
172072937 80 AY 81 
222084067 80 AY 81 
7524738   80 AY 81 
237688639 80 AY 81 
237688570 80 AY 81 
295136986 80 AY 81 
295136960 80 AY 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap