Conserved Protein Domain Family
psbE

?
CHL00064: psbE 
photosystem II protein V
Statistics
?
PSSM-Id: 177004
View PSSM: CHL00064
Aligned: 172 rows
Threshold Bit Score: 146.415
Threshold Setting Gi: 237688667
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466807   1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITDRFDSLEQLDEFS 80 
7524642    1 MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDPLEQLDEFT 80 
29565605   1 MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDPLEQLDEFT 80 
237688530  1 MSGNTGERSFADIITSIRYWVIHSITIPSLXXXXXXXXSTGLXXXXXXXXXXNEYFTESRQEVPLVXXXXXPLEQLDEFT 80 
150251487  1 MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQEVPLITGRSDPLEQLNEFT 80 
237688667  1 MSGNTGERSFADIITSIRYWVIHSITIPSLXXXXXXXXSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDPLEQLDEFT 80 
237688467  1 MSGNTGERSFADIITSIRYWVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTXSRQEVPLVTGRFDPLEQLDEFT 80 
237688599  1 MSGNTGERSFADIITSIRYWVIHSITIPSLXXXXXXXXXXXXXXXXXGSPRPNEYFTESRQEVPLVTGRFDPLEQLDEFT 80 
255961318  1 MSGSTGERPFADIITSIRYRVIHSITIPSSSIAGRLFVSTGLAYDVSGSPRPNEYSTESRRDIPLITGRFDSSEQIDEFT 80 
222084101  1 MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDPLEQLDEFT 80 
11466807  81 RSF 83 
7524642   81 RSF 83 
29565605  81 RSF 83 
237688530 81 RSF 83 
150251487 81 RSF 83 
237688667 81 RSF 83 
237688467 81 RSF 83 
237688599 81 RSF 83 
255961318 81 GSS 83 
222084101 81 RSF 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap