Conserved Protein Domain Family
atpA

?
CHL00059: atpA 
ATP synthase CF1 alpha subunit
Statistics
?
PSSM-Id: 176999
View PSSM: CHL00059
Aligned: 174 rows
Threshold Bit Score: 734.846
Threshold Setting Gi: 301500919
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500919   1 M---SSNTSLCKASDGVILSKTLPELQLGELVLFDTGYKGIALTLSQKETCILLLGKPLAlisLTNGTSIWPTEHLLKVP 77 
90994433   23 DvevANIGTVLQVGDGIARVYGLDEVMAGELLEFEDKTIGVALNLESDNVGVVLMGDGRD---ILEGSSVKGTGRIAQIP 99 
115443540  23 ElklNNVGVVFKVGDGIVRVFGLQGAMAGELLLFEEGSVGIAFNLEKNNIGVVLLGDCTL---IQEGMIVKGTGKIGEVP 99 
11465708   23 DvevANIGTVLQVGDGIARVYGLDEVMAGELLEFEDKTIGVALNLESDNVGVVLMGDGRD---ILEGSSVKGTGKIAQIP 99 
30468238   23 QvqfNHVGTVMQVGDGIARVYGLNDVMAGELLEFADGTIGIALNLESDHVGAVLMGDGRN---ILEGSEVKSSGQIAQVP 99 
51209988   23 EiqvANIGTVLQVGDGIARVYGLDEVMAGELLEFEDQTIGIALNLESDNVGVVLMGEGRN---ILEGSSVKATGKIAQIP 99 
283794874  23 TvctSHIGTVVQSADGMARAYGLDQVMMGELVEFEDRTLGIVLNLEVNNVGIMILGNSRT---IIEGTSVKATGKIAHIP 99 
11467516   23 DvkvDNIGTVLQVGDGIARVYGLDQVMSGELLEFEDKTIGIALNLENDNVGVVLMGNGRQ---ILEGSTVKTTGQIAQIP 99 
118411112  23 DvkiDNIGTVLQVGDGIARVYGLDQVMSGELLEFEDKTIGIALNLENDNVGVVLMGNGRQ---ILEGGSVKSTGQIAQIP 99 
299830569  23 EvkvDNIGTVLQVGDGIARVYGLDQVMSGELLEFEDKTIGIALNLENDNVGVVLMGTGRQ---ILEGSTVKATGRIAQIP 99 
301500919  78 VGKRLLGCVVDPLGTILKLPSANTKKSKkklpyRRIETASPGIIMRQSVDTPVLTGILVVDNLVPIGRGQRELIIGDRQT 157
90994433  100 VGDAFLGRVVDPLARPIDDKGEPASNGT-----RLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELIIGDRQT 174
115443540 100 VGDKFLGRIVDSLANPIDGKGDIVSSQT-----RLIEPPAPGIVDRRSVYEPLQTGITAIDAMIPIGRGQRELIIGDRQT 174
11465708  100 VGDAFLGRVVDPLARPIDNKGEPASNGT-----RLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELIIGDRQT 174
30468238  100 VGEELLGRVVNALVQPIDGKGGIETKQT-----RLIESPAPGIVARQSVCEPLQTGITAIDAMIPIGRGQRELIIGDRQT 174
51209988  100 VGDAFLGRVVDPLARPIDAKGLPNSSGT-----RLIESYAPGIIGRQSVCEPLQTGITAIDSMIPIGRGQRELIIGDRQT 174
283794874 100 VGKNYLGRIIDALGNPVDGKGDIYTEDT-----SLIEPPAPGIISRAPITEPIHTGIITIDSMIPIGRGQRELIIGDRQT 174
11467516  100 TGEAFLGRVVNPLGAPIDGKGDIANTET-----RLLEAMAPGIISRKSVCEPLQTGITSIDAMIPIGRGQRELIIGDRQT 174
118411112 100 VGEAFLGRVVNPLGAPIDGKGDIASTET-----RLVESMAPGIISRKSVCEPLQTGITSIDAMIPIGRGQRELIIGDRQT 174
299830569 100 VGEGFLGRVVNALGAPIDGKGEIASTET-----QLLEAMAPGIISRKSVCEPLQTGITSIDAMIPIGRGQRELIIGDRQT 174
301500919 158 GKTSIAIDTILNQNCVDGIeyCIYVNIGQRSVTVGEIRKVLEEGGALKYTVLINAASDAGAALQYIAPFVGTTQAEYFLY 237
90994433  175 GKTAVALDTIINQKGQDVV--CVYVAIGQKASSVAQVVSSLQDKGALDYTIIVAANADSPATLQYIAPYTGAALAEYFMY 252
115443540 175 GKTAVAIDTILNQKGKDVK--CVYVAVGQKSSSIAQVVTTLQDKGALDYTILVSAAADTTATMQYIAPYSGTALAEYFMY 252
11465708  175 GKTAVALDTIINQKGQDVV--CVYVAIGQKASSVAQVVSSLQEKGALDYTIIVTANADSPATLQYIAPYTGAALAEYFMY 252
30468238  175 GKTAIALDTIINQKNEDVI--CVYVAIGQKASSVAAAVNLLATKGAMDYTIVVTANADDAASLQYLAPYTGAAIAEHFMY 252
51209988  175 GKTAVALDTIINQKGQDVV--CIYVAIGQKASSVAQVVSTLQDESALDYTIVVASNADDPATLQYIAPYTGAALAEYFMY 252
283794874 175 GKTSLAIDTILNQKDEGVI--CIYIAIGQKASSVRSIAHILQEKGALEYTTILSASSEESAALQYIAPYTGTAIGEYFMH 252
11467516  175 GKTAIAVDTIINQKTEDVV--CVYVGVGQKASTVAQVVNVLEEKEAMAYTIIVCASANDPATLQYIAPYAGAALAEYFMY 252
118411112 175 GKTSIAVDTIINQKTEDVV--CVYVGIGQKASTIAQVVNVLDEKEAMAYTIIVSASANDPATLQYIAPYSGAALAEYFMY 252
299830569 175 GKTAIAIDTIINQKKENVI--CVYVGVGQKASTVAQVVNVLEEKGAMSYTIIVSASANDPATLQYIAPYAGAALAEYFMY 252
301500919 238 SGHDCLIIYDDLSKHAQAYRELSLILRRPPGREAYPGDIFYLHSRLLERASKLTSFLGGGSLTALPVIETQGNDVSAYIP 317
90994433  253 KGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAELGGGSMTALPIIETQAGDVSAYIP 332
115443540 253 NGSHALVVYDDLSKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDSLGGGSLTALPIVETQEGDVSAYIP 332
11465708  253 KGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSDLGGGSMTALPIIETQAGDVSAYIP 332
30468238  253 QGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNKELGGGSMTALPIVETQAGDVSAYIP 332
51209988  253 KGKATLVVYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSELGGGSMTALPIIETQAGDVSAYIP 332
283794874 253 QGQSVLIIYDDLSKHATAYRQLSLILRRPPGREAYPGDVFYAHSKLLERSAKLNPKLGGGSITAIPIIETQASDVSAYIP 332
11467516  253 NGKATLVIYDDLTKQAMAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPVIETQASDVSAYIP 332
118411112 253 NGKATLIVYDDLTKQAMAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPIIETQASDVSAYIP 332
299830569 253 KGKATLVIYDDLTKQAMAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPVIETQASDVSAYIP 332
301500919 318 TNVISITDGQIYLSQELFNSGIRPALNVGLSVSRVGSAAQPKPIKKLVGPLKITLAQFIELKSFAQFSTELDDATAMILQ 397
90994433  333 TNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLA 412
115443540 333 TNVISITDGQIFLSSDIFNAGFRPAINVGISVSRVGSAAQPKAMKRVAGKLKLELAQFAELEAFSQFASDLDQATQNQLA 412
11465708  333 TNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLA 412
30468238  333 TNVISITDGQIFLSSDLFNAGIRPAINVGISVSRVGSAAQIQSMKKVAGRLKLELAQFDELQAFSQFASDLDKATQMQLA 412
51209988  333 TNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLS 412
283794874 333 TNVISITDGQIFLSGDLFNSGVRPAINIGISVSRVGSSAQTKAIKKISGKLKLELSQFYELETFSQFTSDLDRSTKNQLA 412
11467516  333 TNVISITDGQIFLSNDLFNSGIRPAINVGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDEATQKQLA 412
118411112 333 TNVISITDGQIFLSNDLFNSGIRPAINVGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDEATQKQLA 412
299830569 333 TNVISITDGQIFLSNDLFNSGIRPAINVGISVSRVGSAAQTKAMKKVAGKLKLELAQFAELEAFSQFASDLDEATQKQLA 412
301500919 398 NGERLQIALTQRQGRPYHLVQSFIRTYVTVNSFLNNIEPAAVlrildlvvytylwfiysqwsewivdssgntkmESYFNS 477
90994433  413 RGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDIEVSKV--------------------------------AEFIRE 460
115443540 413 RGKRLREILKQPQYSPLSLENQVGIIFAGTNGYLDKVSIENI--------------------------------PSYITS 460
11465708  413 RGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDIAVNKV--------------------------------PDFIIK 460
30468238  413 RGQRLREVLKQSQASPIPIEEQIAMIYAGVNGWLDKLALEEV--------------------------------QPFLSR 460
51209988  413 RGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDINLSQV--------------------------------QEFIEA 460
283794874 413 RGQRLREILKQPQYSPIPVHEQVAIIYAATNNFLDDIPIKNI--------------------------------KQFIEY 460
11467516  413 RGTRLREVLKQPQNSPLSVAEQVALIYTGINGFLDELEVASV--------------------------------KKYCAS 460
118411112 413 RGTRLREILKQPQNSPLSVAQQVALIYAGINGFLDNLAVSDV--------------------------------KKFSAS 460
299830569 413 RGTRLREVLKQPQNSPLSVAQQVALIFTGINGFLDDLPVADV--------------------------------KKYCAS 460
301500919 478 LRRNLRRSVGREKKLLLMIGSLNQKAylksfaqalgiqfleakvgpsnqmelligeifpeiatfleeEAQKRRAEEEALE 557
90994433  461 LREDLKNSKPEFGENVRSTKKLEPVS-----------------------------------------EELLKRAIEDVKQ 499
115443540 461 LTESLKNEKSKFGDVILSTKDFTKDE-----------------------------------------ENVLRNILEAS-- 497
11465708  461 LREDLKNSKPEFGESIRSSKKLDTAS-----------------------------------------EELLKKAIEDVKQ 499
30468238  461 VRSELRTSN--YPSAVKSK--WSEEV-----------------------------------------EQMLKDVLSKHAQ 495
51209988  461 LREDLRNSKPEFGESIRTTKKLSAEA-----------------------------------------EELLKQSIEDVKQ 499
283794874 461 LKTTIKNRGTKYTKLIMKSKDLEEKT-----------------------------------------EQALKELIIEAKE 499
11467516  461 LLSFLNTSNNSYIGIVSSTNQFTAEA-----------------------------------------ETALKEAISESKA 499
118411112 461 LIQTLASQKS-YIDVVGKTNQFTEEA-----------------------------------------ETLLKEAIASTKT 498
299830569 461 LLSYIESSKKQYIEIVSSTNQFTDEA-----------------------------------------ESLLKEAIAESKA 499
301500919 558 KQSQKQN 564
90994433  500 GFDKA-- 504
115443540     -------    
11465708  500 GFVKA-- 504
30468238      -------    
51209988  500 AFSV--- 503
283794874 500 SFATHST 506
11467516  500 VFMK--- 503
118411112 499 GFATL-- 503
299830569 500 LFVKN-- 504
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap