Conserved Protein Domain Family
petD

?
CHL00058: petD 
cytochrome b6/f complex subunit IV
Statistics
?
PSSM-Id: 176998
View PSSM: CHL00058
Aligned: 171 rows
Threshold Bit Score: 245.681
Threshold Setting Gi: 301500850
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29565637    1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPSMIGEPANPFATPLEILPEWY 80 
11467614    1 MSVLKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTLACVIGLSVLAPSPIGEKADPFATPLEILPEWY 80 
299830536   1 MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPLTMLGTLACCVGLATLAPTQMGEPADPFNTPLEILPEWY 80 
11467503    1 MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVCILGTFACCIGLAVMAPTQMGEPADPFNTPLEILPEWY 80 
90994531    1 MSILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIIGTFACSIGLAILEPSSIGEKSNPFATPLEILPEWY 80 
299830331   1 MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPLTMLGTLACCVGLATLAPTQMGEPADPFNTPLEILPEWY 80 
11465806    1 MSILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVILGTIACSIGLAILEPSSLGEKSNPFATPLEILPEWY 80 
71842222    1 MSILKKPDLADPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCILGTIACCIGLGVLEPTPLGEKADPFATPLEILPEWY 80 
149072109   1 MSVLKKPDLNDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVAILGTLSCVIGLSVMSPSPLGEKADPFATPLEILPEWY 80 
118410997   1 MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPLTMLGTLTCIVGLSVLAPTQLGEPADPFNTPLEILPEWY 80 
29565637   81 LFPVFqilrtvpnQILRTVPNKLLGVLLMASVPAGSLTVPFLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALPID 160
11467614   81 FFPTF--------NLLRVIPNKLLGVLSMAAVPVGLITVPFIESVNKFQNPFRRPVAMTVFVFSVVFAIWLGIGATMPIN 152
299830536  81 FFPTF--------NLLRVLPNKLLGVLAMAAVPAGLITVPFIENVNKFQNPFRRPIASLMFILGFFTAVWLGIGACLPID 152
11467503   81 FFPTF--------NLLRVLPNKLLGVLAMARVPAGLITVPFIENVNKFQNPFRRPIASLVFILGFFTAVWLGIGACLPID 152
90994531   81 FFPTF--------NLLRVIPNKLLGVLSMAAVPAGLLTVPFIENVNKFQNPFRRPIATTVFLIGTVVSIWLGIGATMPIN 152
299830331  81 FFPTF--------NLLRVLPNKLLGVLAMAAVPAGLITVPFIENVNKFQNPFRRPIASLTFILGFFTAVWLGIGACLPID 152
11465806   81 FFPTF--------NLLRVIPNKLLGVLSMAAVPAGLLTVPFIENVNKFQNPFRRPIATTIFLISTVITIWLGIGATMPIN 152
71842222   81 FFPTF--------NLLRVIPNKLLGVLSMAAVPIGLITVPFIENVNKFQNPFRRPVASLVFLFGTFTAFWLGIGATMPIT 152
149072109  81 FFPTF--------NLLRVIPNKLLGVLSMAAVPAGLITVPFIESINKFQNPFRRPIAMALFLFSIVVAIWLGIGACMPIN 152
118410997  81 FFPTF--------NLLRVLPNKLLGVLAMAAVPLGLITVPFIENVNKFQNPFRRPLASLTFIFGFFTAVWLGIGACVPID 152
29565637  161 ESLTLGLF 168
11467614  153 KALTLGLF 160
299830536 153 KAVSLGFW 160
11467503  153 KAVSLGFW 160
90994531  153 NAITLGLF 160
299830331 153 KAVSLGFW 160
11465806  153 NAITLGLF 160
71842222  153 QALTLGFF 160
149072109 153 KALTLGFF 160
118410997 153 KAISLGFW 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap