Conserved Protein Domain Family
rpl14

?
CHL00057: rpl14 
ribosomal protein L14
Statistics
?
PSSM-Id: 176997
View PSSM: CHL00057
Aligned: 180 rows
Threshold Bit Score: 151.576
Threshold Setting Gi: 11496542
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11466826    1 MIQPQTLLNVADNSGARKLMCIRVIGaASNQRYARIGDVIVAVIKDAVPQMPLERSEVIRAVIVRTCKEF-KCEDGIIIR 79 
11496542    1 MTQLNSFFYVSDNTGVKKIFSIQNIT--RNSFLVNTTDIILGIIKEISFKSSFKYSEIVYGFVVRLKKTQ-NIQNRYNYI 77 
108773413   1 MIQAQTILQVADNTGAKEIMCIRVLR-GSSKKGARVGDIIVAVVKKTKKQTSVKKSEIVRAVIVRTRTTI-HRANGMHLK 78 
115443551   1 MVQPQSRVKVVDNSGAKEIVCIRVLG-KGRNQLSNIGDIIIGVVKEAIPNTPLKKSDIVRAVVVRTRKGL-KRKNGIYIR 78 
12545440    1 MIQTQTYLNVSDNSGAKKIMCISIIS--TKRKYAKIGDTIIAVVKKASPNKIIKKSMIVKALIIRTTKPLyRKHNNMYIS 78 
31442371    1 MTQINTYFNIADNSGVKKILCIQNLT--KKTKKIEIGDLIVGVIKKINNTSKLIYSNIVYGIVIRLKKNI-NLYKKYNIS 77 
301500967   1 MVQKQTRLLVTDNSGAKQILCIGIIS--SKGKTATVGDVILGVVKNSYPDMPVKKSDLVKAVVVRTKKPI-NRPDGSQLY 77 
11467012    1 MIKPQTYLKIADNTGAQKIMCIRILG--PNCQYANIGDIIIAVVKEAIPNMVVKKSDIVKAVIVRTVKGV-RRESGMAIR 77 
260780669   1 MIQSQTYLNVADNTGAKQIMCIRILN-CGARKFAKIGDIIIGVVKQSTPNMPIKKSEIVRAVIVRTCKPF-RRKNGFLIQ 78 
224179439   1 MIQAQTYLTVADNSGARKLMCIRVLG-TNRPKYARVGDIIIAVVKEALPNMPVKKSDIVRAVIVRTKKPI-QREDGMTIR 78 
11466826   80 YDDNAAVIIDQKGNPKGTRVFGAIAEELRELNFTKIVSLAPEVL 123
11496542   78 FNENAVILIDKNFNPLGTRIFGLFPENLKNNNYLKLNSLVLNII 121
108773413  79 FNENAAVLVTKELHPKGTRLFGPIPYECSEAGLNSIISLAPYII 122
115443551  79 FDDNAAVIVNKENNPRGTRIFGPVARELRDKSFMKIVSLAPEVI 122
12545440   79 FNENAAIIINTDNTLKGTNIFGPVPRELMNIGFTNLNSTAKLII 122
31442371   78 FNDNSAVLVDKNLNPIGSRIFGTIPKFLKKKNYLKLYSLTVDFI 121
301500967  78 FSDNAAVVVNNNYDPVGSRIFGPVAREVRDKKMLKLISLAEEVL 121
11467012   78 FDENAAVIINNDRSPKGTRIFGPIARELREKEFVKIMSLAPEVV 121
260780669  79 FDDNAAVIVNKEGAPRGTRIFGPVARELRDSDFMKIISLAPEVL 122
224179439  79 FDENAAVVLNAADNPRGTRVFGPIARELRDKDFGKIISLAPEVI 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap