Conserved Protein Domain Family
psaA

?
CHL00056: psaA 
photosystem I P700 chlorophyll a apoprotein A1
Statistics
?
PSSM-Id: 176996
View PSSM: CHL00056
Aligned: 172 rows
Threshold Bit Score: 1415.66
Threshold Setting Gi: 255961357
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153012221   1 MIIRSPEPKvkilvdpeVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFS 80 
124112136   1 MTISPPEQEa------sVKIVVDRDPVKTSFERWAKPGHFSRTLAKGPNTTTWIWNLHADAHDFDSHTNDLEDISRKVFS 74 
11467832    1 MTISPPEREak-----kVKIVVDRNPVVTSFEKWAKPGHFSRTLAKGPTTTTWIWDLHADAHDFDSHTTDLEDISPKIFS 75 
224178054   1 MTISPPEREak-----kVKIVVDRNPVVTSFEKWAKPGHFSRSLSKGPATTTWIWDLHADAHDFDSHTTDLEEISRKVFS 75 
226968648   1 MTISPPEREvk-----aVKIVVDRDPVPTSFEKWGKPGHFSRTLAKGPATTTWVWDLHADAHDFDSHTTDLEDISRKVFS 75 
226968565   1 MTISPPEREvk-----aVKIVVDRDPVPTSFEKWGKPGHFSRTLAKGPATTTWVWDLHADAHDFDSHTTDLEDISRKVFS 75 
224179420   1 MTISPSEREtl-----kVRVAVDRDPVETSFEKWAQPGHFSRSLSKGPTSTTWVWNLHADAHDFDSHTTDLEDISRKVFS 75 
108796960   1 MTISPPEREak-----kVKIVVDRDPVETSFEKWAKPGHFSRTLSKGPTTTTWIWNLHADAHDFDAQTTDLEEISRKVFS 75 
113170462   1 MTISPPEREik-----tVKIVVDRDPVPTSFEKWAKPGHFSRTLAKGPATTTWVWDLHADAHDFDSHTTDLEDISRKVFS 75 
224179472   1 MTISPPNTTk-------VKIVVDRNPVETSFEKWAKPGHFSRTLSKGPTTTTWIWNLHADAHDFDSHTTDLEDISRKVFS 73 
153012221  81 AHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITN 160
124112136  75 AHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITS 154
11467832   76 AHFGQLGVILIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITS 155
224178054  76 AHFGQLAIIFIWISGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQIWRASGITS 155
226968648  76 AHFGQLGVIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGVQITSGFFQLWRGSGITS 155
226968565  76 AHFGQLGVIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGVQITSGFFQLWRGSGITS 155
224179420  76 AHFGQLAIILVWLSGMYFHGARFSNYEAWLTDPTHVRPSAQVVWPIVGQEILNGDVGGGFQGVQITSGFFQLWRASGITS 155
108796960  76 AHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITT 155
113170462  76 AHFGQLGVIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGVQITSGFFQLWRGSGITS 155
224179472  74 AHFGQLGIILIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRGSGITS 153
153012221 161 ELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPK 240
124112136 155 ELQLYSTAIGGLVMAGLMLFAGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINKLLDAGVDPK 234
11467832  156 ELQLYSTAIGGLLLAAAMFFAGWFHYHKAAPKLEWFQNVESMMNHHLGGLLGLGSLGWAGHQIHVSLPVNKLLNAGVDPK 235
224178054 156 ELQLYSTAIGGLLMAGLMFFAGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGCLSWAGHQIHIALPVNKLLDAGVDPK 235
226968648 156 ELQLYSTAIGALICAGLMFFAGWWHYHKAAPKLEWFQNVESMMNHHLAGLLGLGSLSWAGHQIHIALPVNTLLDAGVDPK 235
226968565 156 ELQLYSTAIGALICAGLMFFAGWWHYHKAAPKLEWFQNVESMMNHHLAGLLGLGSLSWSGHQIHIALPVNTLLDAGVDPK 235
224179420 156 ELQLYSTAIGGLILAGAMLFAGWFHYHKAAPRLEWFQSVESMLNHHLAGLLGLGSLSWAGHQIHISLPINRLLDAGVDPK 235
108796960 156 ELQLYSTAIGGLVMAAAMFFAGWFHFHKSAPKLEWFQNVESMLNHHLSGLLGLGSLAWAGHQIHVSLPINKLLDAGVDPH 235
113170462 156 ELQLYSTAIGALICAGLMFFAGWWHYHKAAPKLEWFQNVESMMNHHLAGLLGLGSLAWAGHQIHIALPVNTLLDAGVDPK 235
224179472 154 ELQLYSTAIGGLILAGLMFFAGWFHYHKAAPKLEWFQNVESMMNHHLAGLLGLGSLAWAGHQIHVSLPVNALLDAGVDAK 233
153012221 241 EIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTN 320
124112136 235 EIPLPHEFLVNRDLTAQLFPSFAKGLTPFFTLNWAEYSDFLTFKGGLNPVTGGLWLTDTAHHHLAIAVLFLVAGHMYRTN 314
11467832  236 EIPLPHEFLLNRDLMAQLYPSFAKGLTPFFTLNWAEYGDFLTFRGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTN 315
224178054 236 EIPLPHEFLLNRELMAQLFPSFGKGLTPFFTLNWAEYTDILTFRGGLNPVTGGLWLSDTAHHHLALAVLFLVAGHMYRTN 315
226968648 236 EIPLPHEFMLNRDLMAELYPSFSQGLAPFWTFNWTEYSDFLTFRGGLNPVTGGLWLSDTAHHHLAIGVLFIIAGHMYRTN 315
226968565 236 EIPLPHEFMLNRDLMAELYPSFSQGLAPFWTFNWTEYSDFLTFRGGLNPVTGGLWLSDTAHHHLAIGVLFIIAGHMYRTN 315
224179420 236 EIPLPHEFLMDSSLMADLYPSFGLGLAPFFSLQWAEYQDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRTN 315
108796960 236 EIPLPHELILNPSLMAQLYPSFKQGLAPFFTLNWSEYSDFLTFQGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRTN 315
113170462 236 EIPLPHEFMLNRALMAELYPSFAKGLTPFFTFNWTEYSDFLTFRGGLNPVTGGLWLTDMAHHHLAIAVLFLVAGHQYRTN 315
224179472 234 EIPLPHEFILNRALMAEIYPSFAKGLAPFFTLQWSEYSDFLTFKGGLNPVTGGLWLTDTAHHHLAIAVLFIIAGHQYRTN 313
153012221 321 WGIGHGIRDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHM 400
124112136 315 WGIGHSIKEILEAHKGPFTGAGHRGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSIFTHHT 394
11467832  316 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALFGSLSIVVAHHMYAMPPYPYLATDYGTQLSLFTHHM 395
224178054 316 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLAMMGSVSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHM 395
226968648 316 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHM 395
226968565 316 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHM 395
224179420 316 FGIGHSIQEILEAHRGPFTGEGHKGLYEVLTNSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHV 395
108796960 316 WGIGHSMKEILDAHKGPFTGEGHKGLYEILTTSWHAQLAINLALFGSLSIIVAHHQYSMPPYPYLATDYATQLSLFTHHN 395
113170462 316 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALMGSLSIIVSHHMYSMPPYPYLATDYGTQLSLFTHHM 395
224179472 314 WGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLGLNLAFFGSLSMIVSHHMYAMPPYPYLATDYGTQLSLFTHHM 393
153012221 401 WIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRILRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 480
124112136 395 WIGGFCIVGGAAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 474
11467832  396 WIGGFCVVGAAAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
224178054 396 WIGGFCVVGAAAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAMISHLNWICIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
226968648 396 WIGGFCICGAAAHAAIFMVRDYDPTNNYNNLLDRVLRHRDAMISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
226968565 396 WIGGFCICGAAAHAAIFMVRDYDPTNNYNNLLDRVLRHRDAMISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
224179420 396 WIGGFCIVGAGAHAAIFMVRDYDVAGNYNNLLDRVIRHRDAIISHLNWVSIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
108796960 396 WIGGFCIVGAAAHAAIFMIRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPADMFSDT 475
113170462 396 WIGGFCICGAAAHAAIFMVRDYDPATNYNNVLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 475
224179472 394 WIGGFCVTGAAAHAAIFMVRDYDPTNNYNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDT 473
153012221 481 AIQLQPVFAQWIQNTHALAPGT-TAPGATASTSLTWGGgDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKG 559
124112136 475 AIQLQPVFAQWIQNTHYLAPNL-TAPNALAPTSATWGG-DVVAVGGKVAMMPISLGTADFLVHHIHAFTIHVTVLILLKG 552
11467832  476 AIQLQPVFAQWIHKTHALAPGL-TAPNALASTSPSWGG-DVVAVGGKVAMMPISLGTADFLVHHIHAFTIHVTVLILLKG 553
224178054 476 AIQLQPVFAQWVQKTHYLAPNL-TAPNALTSTSPTWGG-DIVAVGGKIAMMPISLGTADFMVHHIHAFTIHVTVLILLKG 553
226968648 476 AIQLQPIFAQWVQNTHALAPEL-TAPTAGASTSASWGG-DIVAVGGKIAMMPISLGTSDFMVHHIHAFTIHVTVLILLKG 553
226968565 476 AIQLQPIFAQFVQNTHALAPEL-TAPTAGASTSASWGG-DIVAVGGKIAMMPISLGTSDFMVHHIHAFTIHVTVLILLKG 553
224179420 476 AIQLQPIFAQWVQSTHYLAPET-TAPYATLATSPTWGG-DIVAVGGKVAMMPIPLGTADFMVHHIHAFTIHVTVLILLKG 553
108796960 476 AIQLQPVFAQWIQKTHFLAPGF-TAPNALASTSPSWGG-DVVAVGGKVAMMPISLGTSDFLVHHVHAFTIHVTVLILLKG 553
113170462 476 AIQLQPIFAQFVQHTHALAPEL-TAPTAAGSTSASWGG-DIVAVGGKIAMMPISLGTSDFMVHHIHAFTIHVTVLILLKG 553
224179472 474 AIQLQPVFAQWIQNTHSLSSISvTAPNALGSTSQSWGG-DIVAVGGKIAMMPISLGTSDFMVHHIHAFTIHVTVLILLKG 552
153012221 560 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGSINDQGVVTHITG 639
124112136 553 VLFARSSRLIPDKVNLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIAIFHFSWKMQSDVWGSVTAKG-VSHITG 631
11467832  554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGNVTAQG-VSHITG 632
224178054 554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHIFLGLFWMYNSISIVIFHFSWKMQSDVWGNLTAKG-VSHITG 632
226968648 554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGSVTDNG-VSHITG 632
226968565 554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGSVTDNG-VSHITG 632
224179420 554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGSATANG-VTHITG 632
108796960 554 VLYARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGTVNASG-ISHITG 632
113170462 554 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGSVTGNG-VSHITG 632
224179472 553 VLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSVTIFHFSWKMQSDVWGSLGSTGTVSHITG 632
153012221 640 GNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 719
124112136 632 GNFAQSSITINGWLRDFLWAQASQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 711
11467832  633 GNFALSSNTINGWLRDFLWAQASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPS 712
224178054 633 GNFALSANTINGWLRDFLWAQASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
226968648 633 GNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
226968565 633 GNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
224179420 633 GNFAQSANTINGWLRDFLWAQASQVIQSYGSALSAYGLVFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
108796960 633 GNFAQSANTINGWLRDFLWAQSSQVIQSYGSSLSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
113170462 633 GNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPA 712
224179472 633 GNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLRVAPS 712
153012221 720 TQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG 758
124112136 712 IQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIIAVG 750
11467832  713 IQPRALSITQGRAVGVAHYLLGGIATTWAFFLARIIAVG 751
224178054 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
226968648 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
226968565 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
224179420 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
108796960 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
113170462 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
224179472 713 IQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG 751
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap