Conserved Protein Domain Family
psaB

?
CHL00054: psaB 
photosystem I P700 chlorophyll a apoprotein A2
Statistics
?
PSSM-Id: 176995
View PSSM: CHL00054
Aligned: 171 rows
Threshold Bit Score: 1366.72
Threshold Setting Gi: 301500958
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179048    1 MATKlFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVT 80 
118410963   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDGMTEENLYQKIFASHFGHLAVIFLWTAGNLFHVAWQGNFEKWVS 79 
71842224    1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFQQWVL 79 
11467712    1 MATK-FPKFSQALAQDPATRRIWYGLATAHDFESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFEQWVL 79 
149072048   1 MATK-FPKFSQALAQDPATRRIWYGLATAHDLESHDGMTEENLYQKIFASHFGHLAVIFLWTSGNLFHVAWQGNFEQWVL 79 
242620083   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDSMTEETLYQKIFASHFGHLAVIFLWTSGNLFHVAWQGNFEQWIQ 79 
242624310   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDNMTEESLYQKIFASHFGHLAVIFLWTSGNLFHVAWQGNFEQWIQ 79 
299830311   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDGMTEENLYQKIFASHFGHLAVIFLWTSGNLFHVAWQGNFEKWVG 79 
299830504   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDGMTEENLYQKIFASHFGHLAVIFLWTSGNLFHVAWQGNFEKWVG 79 
118411097   1 MATK-FPKFSQALAQDPATRRIWYGIATAHDLEAHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFEKWVS 79 
41179048   81 DPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQP 160
118410963  80 NPLKVKPIAHAIWDPHFGESAIKAFSKGNTY-PVNIAFSGVYQWWYTIGFRTNQELYLGSVGLLILASVLLFAGWLHLQP 158
71842224   80 NPLKVKPIAHAIWDPHFGQSAIKAFTRGGVSYPVNIATSGVYHWWYTVGMRTNEDLYFGALGLLVLSTTLLFAGWLHLQP 159
11467712   80 NPLKVKPIAHAIWDPHFGQPAVKAFTKGGVSYPVNIATSGVYHWWYTIGMRTNNDLYSGSIFLLILASVMLFAGWLHLQP 159
149072048  80 NPLKVKPIAHAIWDPHFGQPAVKAFTKGGVSYPVNIATSGVYHWWYTIGMRSNTDLYAGSLFLLFLAGVFLFAGWLHLQP 159
242620083  80 NPLKVKPIAHAIWDPHFGEPALKAFTKGGLSYPGNIAYSGVYHWWYTIGMRTNQQLYVGSIFLLGLAALLLYAGWLHLQP 159
242624310  80 NPLKVKPIAHAIWDPHFGEPALKAFTKGGLSYPGNICYSGVYQWWYTIGMRTNSELYAGSLFLLVLSAVLLYAGWLHLQP 159
299830311  80 NPLKVKPIAHSIWDPHFGDSALKAFSKGNTY-PVNIAYSGVYHWWYTIGFRTNQELYAGSIGLLLLSCVLLFAGWLHLQP 158
299830504  80 NPLKVKPIAHSIWDPHFGDSALKAFSKGNTY-PVNIAYSGVYHWWYTIGFRTNQELYAGSIGLLLLASVLLFAGWLHLQP 158
118411097  80 NPLKTRPIAHSIWDPHFGESALKAFSKGNTY-PVNITFSGLYQWWYTIGFRTNQELYKGSIGLLLLASVLLIAGWLHLQP 158
41179048  161 NFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDT 240
118410963 159 KFRPSLAWFKNNESRLNHHLSGLLGVSSLAWTGHIVHVAIPASRGVHVGWENFLTTPPHPAGLTPFYSGDWTVYAANPDS 238
71842224  160 KFRPGIAWFKNNESRLNHHLSGLFGVSSLAWSGHLIHVAIPESRGQHIRWNNFTSTLPHPEGLTPFFTGNWGLYAENPDT 239
11467712  160 KFRPGLAWFKNNESRLNHHLSGLFGFSSVAWSGHLIHVAIPESRGLHVGWDNFTKVYPHPEGLKAFFTGNWSNYAANPDT 239
149072048 160 KFRPGLSWFKNNESRLNHHLSGLFGFSSLAWSAHLIHVAIPEARGQHVCWDNFTKVAPHPAGLQPFFTGNWGAYAASPDT 239
242620083 160 KFRPSLSWFKNNESRLNHHLSGLFGFSSVAWTGHLVHVAIPASRGVRVGWDNFLTTLPHPDGLQPFFSGNWGAYAANPDT 239
242624310 160 KFRPSLSWFKNNESRLNHHLSGLFGFSSIAWTGHLVHVAIPASRGVHVGWDNFLTTLPHPAGLQPFFTGNWSVYAQNPDT 239
299830311 159 KFRPSLSWFKNNESRLNHHLSGLLGVSSLAWTGHLVHVAIPASRGVHVGWDNFLTTPPHPAGLTPFFTGNWTVYAENPDS 238
299830504 159 KFRPSLSWFKNNESRLNHHLSGLLGVSSLAWTGHLVHVALPASRGVHVGWDNFLTTPPHPAGLTPFFTGNWTVYAENPDS 238
118411097 159 KFRPSLSWFKNNESRLNHHLSGLLGFSSLAWTGHLVHVAIPASRGVHVGWDNFLTTPPHPAGLTPFFTGNWTVYAENPDS 238
41179048  241 ASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGH 320
118410963 239 ANHVYGTAEGAGTAILTFLGGFHPQTQSLWLSDIAHHQLAIAVVFIVAGHMYRTNFGIGHNMKEILDAHRPPGGRLGAGH 318
71842224  240 AQHIFGTSEGAGTAILTFLGGFHPQTQSMWLTDIAHHHLAIAVVFIFAGHMYRTNWGIGHSMKEILDAHVPPKGRLGAGH 319
11467712  240 ADHIFGTTEGSGTAILTFLGGFHPQTQSLWLTDIAHHHLAIGVIFIFAGHMYRTNWGIGHSLKEILDAHRAPSGRLGNGH 319
149072048 240 TNHIFGTSEGAGTAILTFLGGFHPQTQALWLTDIAHHHLAIGVVFIFAGHMYRTNWGIGHSLKEILDAHRPPGGRLGAGH 319
242620083 240 SQQIFNTSTGAGTAILTFVGGFHPQTQAMWLTDIAHHHLAIGVVFIFAGHMYRTNFGIGHSMKEILDAHRPPGGRLGAGH 319
242624310 240 SEQIFNTTTGAGTAILTFVGGFHPQTQAMWLTDIAHHHLAIGVIFVFAGHMYRTNFGIGHSLKEILEAHREPENRLGAGH 319
299830311 239 ASHVYGTSEGAGTAILTFLGGFHPQTQSLWLSDIAHHQLAIAVVFIVAGHMYRTNFGIGHNMKEILDAHRPPGGRLGAGH 318
299830504 239 ASHVYGTSEGAGTAILTFLGGFHPQTQSLWLSDIAHHQLAIAVVFIVAGHMYRTNFGIGHNMKEILDAHRPPGGRLGAGH 318
118411097 239 ATHVFNTSEGSGTAILTFLGGFHPQTQSLWLSDMAHHHLAIAVVFIVAGHMYRTNFGIGHNMKEILDAHRPPGGRLGAGH 318
41179048  321 KGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYD 400
118410963 319 TGLFETITNSLHMQLGLALACLGVATSLTAQHMYAITPYAFLSKDFTTEAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 398
71842224  320 RGLFETITDSLHMQLGLALASLGVATSLVAQHMYALPSYAFMAKDYVTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 399
11467712  320 KGLFETISNSLHFQLGLALASLGVITSLVAQHMYALPSYAFIAKDYVTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 399
149072048 320 KGIFETLTNSLHFQLGLALASLGVITSLVAQHMYALPSYAFIAKDYVTQSALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 399
242620083 320 RGLFETITNSLHMQLGLALASLGVATSLVAQHMYALPAYAFIAKDFVTQAALYTHHQYIAGFLMLGAFAHGAIFFIRDYD 399
242624310 320 TGLFETITNSLHMQLGLALACLGVATSLVAQHMYALPAYAFISKDFVTQAALYTHHQYIAGFLMLGAFAHGAIFFIRDYD 399
299830311 319 VGLFETITNSLHMQLGLALACLGVATSLTAQHIYALTPYAFLSKDFTTEAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 398
299830504 319 VGLFETITNSLHMQLGLALACLGVATSLTAQHIYALTPYAFLSKDFTTEAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 398
118411097 319 VGLFETITNSLHMQLGLALACLGVATSLTAQHMYALTPYAYLSKDFTTEAALYTHHQYIAGFLMVGAFAHGAIFFVRDYD 398
41179048  401 PEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLS 480
118410963 399 PELNKNNVLARMLEHKEAIISHLSWASLFLGFHTLGLYIHNDTVVAFGQPEKQILFEPLFAEYIQAASGKAVYEFNTLLS 478
71842224  400 PEVNKDNVLARMLQHKEAIISHLSWVSLFLGFHTLGLYIHNDVCVAFGTPEKQILFEPVFAQFIQAASGKALYGFDVLLS 479
11467712  400 PEQNKNNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILVEPVFAQWIQASSGKAMYGFDVLLS 479
149072048 400 PEQNKNNVLARILDHKEAIISHLSWVSLFLGFHTLGIYVHNDVVVAFGTPEKQILVEPVFAQWIQASSGKALYGFDVLLS 479
242620083 400 PELNKDNVLARMLEHKEAIISHLSWVSLFLGFHTLGIYIHNDTVVAFGQPEKQILVEPVFAQWIQASSGKALYGFNTLLS 479
242624310 400 PELNKDNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYIHNDTVVAFGQPEKQILVEPVFAQWIQGASGKALYGFNTLLA 479
299830311 399 PELNKNNVLARMLEHKEAIISHLSWASLFLGFHTLGLYIHNDTVVAFGQPEKQILFEPVFAEYIQAASGKAVYQFNVLLS 478
299830504 399 PELNKNNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYIHNDTVVAFGQPEKQILFEPVFAEYIQAASGKAVYQFNVLLS 478
118411097 399 PELNKNNVLARMLEHKEAIISHLSWASLFLGFHTLGLYIHNDTVVAFGQPEKQILFEPLFAEYIQAASGKAVYQFNVLLA 478
41179048  481 SKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 560
118410963 479 SSTSPATVAGNQIWLPGWLEAINNNKNDLFLKIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 558
71842224  480 SSTSAASVASSKIWLPGWMEAINSGKNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 559
11467712  480 ANTSIAKNASSNIWLPGWLEAINSGKNSLFLPIGPGDFLVHHAIALALHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 559
149072048 480 STNSVAANASSNIWLPGWLEAINSGKNSLFLPIGPGDFLIHHAIALALHTTTLILVKGALDARGSKLMPDKKDFGYAFPC 559
242620083 480 SGDSPATVASSQVWLPGWTEAINSGKNSLFLTIGPGDFLVHHAIALALHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 559
242624310 480 SPDFPGTVASSQIWLPGWTEAINNDKNSLFLTIGPGDFLVHHAIALALHTTTLILVKGALDARGSKLMPDKKDFGYSFPC 559
299830311 479 SSTSPATVAGNQVWLPGWLEAINNDKNDLFLTIGPGDFLVHHAIALGLHVTALILVKGALDARGSKLMPDKKDFGYSFPC 558
299830504 479 SSTSPATVAGNQVWLPGWLEAINNDKNDLFLTIGPGDFLVHHAIALGLHVTALILVKGALDARGSKLMPDKKDFGYSFPC 558
118411097 479 SSTSPATAAGNQVWLPGWLEAINNPKTDLFLKIGPGDFLVHHAIALGLHVTALILVKGALDARGSKLMPDKKDFGYSFPC 558
41179048  561 DGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFG 640
118410963 559 DGPGRGGTCDISAWDAFYLAMFWMLNTIGWVTFYWHWKHMTIWGGNPGQFDESSNYIMGWLRDYLWLNSSPLINGYNPFG 638
71842224  560 DGPGRGGTCDISAWDAFYLAMFWMLNTISWVTFYWHWKHLTVWGGNAAAFNESSTYIMGWLRDYLWLNSSPLINGYNAFG 639
11467712  560 DGPGRGGTCDISAWDAFYLSMFWMLNTIGWVTFYWHWKHVTIWQGNAGQFNESSTYIMGWLRDYLWLNSSPLINGYNPFG 639
149072048 560 DGPGRGGTCDISAWDAFYLSMFWMLNTIGWVTFYWHWKHITIWQGNAGQFNESSTYIMGWLRDYLWLNSSPLINGYNPFG 639
242620083 560 DGPGRGGTCDISAWDAFYLATFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSNYIMGWLRDYLWLNSSPLINGYNPMG 639
242624310 560 DGPGRGGTCDISAWDAFYLATFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSNYLMGWLRDYLWLNSSPLINGYNPMG 639
299830311 559 DGPGRGGTCDISAWDAFYLAMFWMLNTIGWVTFYWHWKHMTIWGGNPGQFNESSNYIMGWLRDYLWLNSSPLINGYNPFG 638
299830504 559 DGPGRGGTCDISAWDAFYLAMFWMLNTIGWVTFYWHWKHMTIWGGNPGQFNESSNYIMGWLRDYLWLNSSPLINGYNPFG 638
118411097 559 DGPGRGGTCDISAWDAFYLAMFWMLNTIGWVTFYWHWKHMTIWGGNPGQFDESSNYIMGWLRDYLWLNSSPLINGYNPFG 638
41179048  641 MNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIF 720
118410963 639 MNNLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWRDKPVALSIVQARLVGLVHFTVGYVL 718
71842224  640 MNAQAVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPIANLVKWRDKPVALSIVQARLVGLAHFTVGFIF 719
11467712  640 MNSLSVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWRDKPVALSIVQARLVGLVHFTVGYIF 719
149072048 640 MNSLSVWSWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWKDKPVALSIVQARLVGLIHFTAGYIF 719
242620083 640 MNNLAVWAWIFLFAHLVWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWRDKPVALSIVQARLVGLVHFGVGYIF 719
242624310 640 MNNLSVWAWMFLFAHLVWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWRDKPVALSIVQARLVGLVHFTVGYIF 719
299830311 639 MNNLSVWAWTFLFAHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIL 718
299830504 639 MNNLSVWAWTFLFAHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFAVGYIL 718
118411097 639 MNNLSVWSWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIL 718
41179048  721 TYAAFLIASTSGRFG 735
118410963 719 TYAAFVIASTAGKYG 733
71842224  720 TFAPFVIASTTGKFA 734
11467712  720 TYAAFVIASTAGKFG 734
149072048 720 TYAAFVIASTTGKFG 734
242620083 720 TYAAFVIASTAGKFG 734
242624310 720 TYAAFVIASTAGKFG 734
299830311 719 TYASFVIASTSGKFA 733
299830504 719 TYASFVIASTSGKFA 733
118411097 719 TYAAFVIASTSGKFA 733
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap