Conserved Protein Domain Family
rps7

?
CHL00053: rps7 
ribosomal protein S7
Statistics
?
PSSM-Id: 176994
View PSSM: CHL00053
Aligned: 266 rows
Threshold Bit Score: 108.818
Threshold Setting Gi: 31442378
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
304322966   1 MSRN--GSLKnkkgksgpgkkadgilrkspiqKRVLLPDPVYNSLSVQMLVNRVLKSGKKSVAYRIVYSVLKKLSESTNE 78 
11465448    1 MSQK--DPYK----------------------TYRLVSDPFYESPLVTLLIMHVLRNGKKSISQRIVYSAIENIAMKVKE 56 
215400746   1 MSRRinSNSK----------------------REFPNPDPIYNSYLVSLLTVRILKNGKKTLAQKIIQKAFSNIKDRTNE 58 
11466994    1 MSRR--RRAK----------------------KRIISQDPIYNSTLASKVINKILLNGKKTLAQYIFYETMKNIQEIYKK 56 
11496547    3 YFYQ--------------------------------------KQFTIFYLIQKLILSGKKRKTGNLVLNFLILFK-RKNK 43 
126165893   3 SEES--MTDQ-------------------------GMTDQSMKSRLVELLIVHVLRKGKKSLARRIVYEALKRIEERNQQ 55 
242620066   1 MSRR--KIIK----------------------KRFPSPDPVYNNYLVSILVSRLIKDGKKTLAQNIVCDALEIIAYKMET 56 
242624292   1 MSRR--KVIK----------------------KKFPLPDPVYNNYLISILITRLIKDGKKNLAQNIVCDALDIIAYRLDV 56 
299830404   1 MSRR--NISK----------------------KRFPEPDSIYNSYLVSLLISRILKSGKKTIAKNLVYEAFEIIQQKTNE 56 
299830625   1 MSRR--NISK----------------------KRFPEPDSIYNSYLVSLLISRILKSGKKTIAKNIVYEAFEIIKQKTNE 56 
304322966  79 NPVFVWEKALSNVQPRVEIKPRRRGGAIQQVPYVVHSVdRAQATAIRWVLLACQKRSGKDMIT--KLLSEILEASKKSGA 156
11465448   57 DPLEIIERAIKNVIPAVEIRSRRIGGSTYQVPTEVRVH-RGISLSIRWVIKFAKIRPGKSMSL--KLANELLDASKNLGN 133
215400746  59 EPLIIFEKAIKNASPIVEVKATRRRGSTYQVPVEVSGF-RATNLALRWLVKFAKERSGRSMAV--KLANELIDTSKGLGN 135
11466994   57 DPLDILRKAIKNASPQMETRKRRIGGTIYQVPVEVKED-RGTSLALKFIIEKARERKGRGIST--KLKNEIIDASNNTGE 133
11496547   44 DYLYNLEKIIIKLMVFFTFKMKKINTSIYQVPQPIIYK-KSLFKAISWLVKAIKNKSKNKISTykKLYLECDNILKQQGK 122
126165893  56 SGVLMLEQAVSQVMPLVCVKARRVGGATYQVPQEVKPY-TGINNALRWIVKYAKDRSGKSMAI--KLAAEIWDAAHGTGG 132
242620066  57 DPIEIFEKAVKNVTPLVEVKARRFGGATYQVPMEVTSF-RGSNLALRWIVKASRKRTGKTIAL--KLAAELMDASKSSGD 133
242624292  57 DPIEVFEQAVKNVTPYVEVKARRFGGATYQVPMEVTSF-RGTNLALRWIVKATKNRPGKTIAL--KLANELIDASNNSGE 133
299830404  57 DPLKVFETAIRKASPIVEVKARRIGGSTYQVPIEVSGF-RATNLSLRWIIQYSKQRVGRSMSI--KLANEIIDTANEIGN 133
299830625  57 DPLKVFEKAIRKASPIVEVKARRIGGSTYQVPIEVSGF-RATNLSLRWIIQYSKQRVGRSMSI--KLANEIIDTANEIGN 133
304322966 157 AFRKKEELHKTALANQMNARKpeK 180
11465448  134 SIRKKEDTHKMAEANRAFAHY--R 155
215400746 136 TIRKKEETHRMAEANKAFSHY--R 157
11466994  134 AVKKKEEIHKTAEANKAFSNM--K 155
11496547  123 ALINRILIYLTYK----------K 136
126165893 133 AIRKKEETHRMAEANKAFAHY--R 154
242620066 134 AIRKKQESHKMAEANKAFAHF--R 155
242624292 134 AIRKKQETHKMAEANKAFAHF--R 155
299830404 134 TIKKKEETHKMAEANKAFAHF--R 155
299830625 134 TIKKKEETHKMAEANKAFAHF--R 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap