Conserved Protein Domain Family
rpl2

?
CHL00052: rpl2 
ribosomal protein L2
Statistics
?
PSSM-Id: 176993
View PSSM: CHL00052
Aligned: 250 rows
Threshold Bit Score: 245.544
Threshold Setting Gi: 71025930
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225544164   1 MAIHLYKTSTPSTRNGAV---DSQV------KSNTRN---NLIYGQHRCGK-GRNARGIITARHRGGG------------ 55 
11465425    1 MAIKKYKPYTPSMRGRVL---AS-DffdlseKKAPKR----LSFGIKSI-S-GRNNQGKITCRHKGGG------------ 58 
260780667   1 MALRYYKTHTPGTRQRSCcdfSNIS------KRRPQR---ALTSAFTRK-R-GKNNRGIITIRHRGGG------------ 57 
31442366    1 MYNMYY-----CKRNKYI---SNYS-------------------------F-GKNNKGHITIKHRQGLfikssqlkntny 46 
11496537    1 MILTFIKIKKYRIKYLII-------------KKQKAF---------------GRNNLGFITCRAKGGGi----------- 41 
30468185    1 ---------------------------------MPVK---SLIKGFHRS-V-GRNVHGKITCRHKGGG------------ 30 
71025930    1 ----------------------------------------MVIFKINYNKKiGKNNYGRIVTRHREKG------------ 28 
153805617   1 MGIRFYKPYTPGTRNRSMaefDQIT------ETKPEK---HLTSWIPRS-K-GRNNRGIITSRHRGGG------------ 57 
224179442   1 MAIRFYNPYTPGNRNHSAldfSELT------RKQPEK---HLVKGQNRS-H-GRNNRGVITCRHKGGG------------ 57 
108773417   1 MTLKKLNPITPGSRHRVI---IDYSkqskllKPSTKNaplKKNTLKIMTTE-GRNFHGVITTRHRGGG------------ 64 
225544164  56 ----HKRLYRKID-----F--RR-NEKDIYGRIVTIEYDP-NRNAYICLIHYGDG----EKRYILHPRGAIIGDTIISGT 118
11465425   59 ----HKRKYRLVD-----F--KR-CKTGVLAKVSDIYYDP-NRSAHIALLNYLDG----EKSYIISPNLLKVGTYVVSGK 121
260780667  58 ----HKRLYRKID-----I--KR-SKYCSLAKVFSIEYDP-NRTAYIALLHYTDG----TKRYILKPKGLKKGDIVQGGE 120
31442366   47 nyifKKNIFNIIN-----YnnKKiIKLQILKKIIDYKLQK-YIYKVICLNNSLNY----QYKYLPITKNTKEGDIIYIGE 116
11496537   42 ----KRNLYKILDsnfanY-----GMSFSSAFYVNIIYDS-FRRIFLAVYFIINSiiknIYRYFLLTKNLKIGSQINFGF 111
30468185   31 ----HKRRYRIIE-----W--QR---KESIAKVAAIEYDP-NRSARLALLHYRDG----TKSYILQASGMKVGDEVKAGV 91 
71025930   29 ----RKSLYIPIDln--yF--NYeTDKKFYIRLLSTESNHmYRNTKLILGLSMEGktkgQLRYIIKPNKKSLGDLIKFTE 100
153805617  58 ----HKRLYRNID-----F--KR-NKLGILGQVATIEYDP-NRNARIAKVHYQDG----EKRYILYPRGLQLGQTILSNF 120
224179442  58 ----HKRLYRTID-----F--RR-GLVETPAKVEAIEYDP-NRTANLALLHYEDG----TKSYILHPRGVKVGDTLLSSL 120
108773417  65 ----HKRLYRIIE-----F--NR-NKLGVSGKVNNIEYDP-NRTANIARIHYQDG----SKKYIIHPEGLEKGANIIASA 127
225544164 119 E-VPIKMGNALPLsevlidqkeestsTDMPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISK 197
11465425  122 E-ASPDIGNALPL-------------NCVPLGFEIHNIELIHGKGGQVARAAGTSAKLIAKSQDYVTIKLPSGEIRLFRG 187
260780667 121 KvAKLDLPDTLPL-------------KNIPLGTEIHNIEITPGRGGQLVKSAGTSAQILAKEGNFVTIRLPSGEIRIILK 187
31442366  117 T-IELKIGNILPI-------------KKIPCGSWIHNIEHNPTKGAVFVKNSKISAFLIYIGKKYVTIKLPSGEIRLLNK 182
11496537  112 K-APLKIGNALPL-------------YKILLGSFIYNIEIRYKGKGSLVKNANHNAIILMIGDIYVTVKLPSGEIKLLLK 177
30468185   92 D-AELQPGHVWPL-------------SAIPLATQVHSIELVANKGAQLVRAAGCFAVVVAKSPSYVALKLPSGEIRQIAA 157
71025930  101 K-TSKHFGDINYL-------------NNFDINDKLYSLEFKPKIKSKICLSAKCVSILLNKENNLIKIKLPSNKIKKLNN 166
153805617 121 N-APITIGNSLPL-------------HQIPLGTEIHNIELKPGSGGQLARAAGSVAQLVAKEGNFVTLRLPSGEIRLVSK 186
224179442 121 R-PPIQSGNALPL-------------ASAPLGTLVHAIELQPGKGAQVARSAGSAAQIVAKEGAAVTLRLPSGEVRLFSR 186
108773417 128 I-APLSIGNSLPL-------------KSIPIGTEIHNIEFHPGKGGQLARSAGTGALVSYKTNSFVTLKLPSGRSRYFDN 193
225544164 198 NCSATVGQVGNTGVNQKSLGR-AGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKY 276
11465425  188 ECYATIGKVGNIDHNNEKIGK-AGRNRWLGIRPTVRGSAMNAVDHPHGGGEGRSPIGRSQPSTPWGRPALGIKTR-RNKF 265
260780667 188 KCWATIGQVSNVDWQLRSIGK-AGRSRWLDRRPHVRGAVMNPVDHPHGGGEGRAPIGRKHPVTPWGKPTLGKKTRKIIKY 266
31442366  183 NVFCILGELNIIPLFLKK-NK-AGFNRLLGKRPKVRGVAMNACDHPHGGGEGKNSIGRSSVYSPWGTISKGIITRKSKKY 260
11496537  178 NLFCILGQLEIRRKVNKNIKKhAGFNRKLSIRPKIRGAAMNAVDHPHGGGEGKASVGFKFARTLWGKAFKGIKTRKKNKH 257
30468185  158 NARATIGRVGNEVHSQRVLGK-AGRSRWLGIRPTVRGSAMNPVDHPHGGGEGRCGIGRSRPLTPWGKPALGVKTRKR--- 233
71025930  167 KCYAVYGN--SEKVISNFKQK-AGTERLFGNRPKVRGSAMNACDHPHGGGEGKAPIGRRSICSFKGKKTKGVKT---VKF 240
153805617 187 SCWATIGQVGNVEQMNLTVGK-AGKSRWLGRRPKVRGVVMNPVDHPHGGGEGRAPIGRSRPVTPWGRPALGQRTRNATKY 265
224179442 187 YCWSTIGQVGNEERANIRLGK-AGRRRWLGIRPRVRGVVMNPCDHPHGGGEGRAPIGRSRPVTPWGQPALGKRTRSNRRY 265
108773417 194 KCWATIGKVSKAEHKFINLGK-AGRSRWLGIRPTVRGSAQNAVDHPHGGGEGKAPIGRI-PSTPWGKPALGIKTRHRHKW 271
225544164 277 SDNLILRRRT 286
11465425  266 SNFYILRRRK 275
260780667 267 SNKLIIRRRK 276
31442366  261 SKKLILKNRK 270
11496537  258 LSRFILQHRL 267
30468185  234 PNIYVLRNRS 243
71025930  241 KNDYIK---- 246
153805617 266 SRNLIIRRRK 275
224179442 266 SEKAILRRRG 275
108773417 272 SERFFKGLKK 281
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap