Conserved Protein Domain Family
rps12

?
CHL00051: rps12 
ribosomal protein S12
Statistics
?
PSSM-Id: 176992
View PSSM: CHL00051
Aligned: 276 rows
Threshold Bit Score: 149.022
Threshold Setting Gi: 71025960
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30352097    1 MPTNQQLIRKARQRLESGTKSPALRGCPQRRGVCTRVYlTTTPKKPNSALRKVARVRL--TSKFEVTAYIPGIGHNLQEH 78 
215400747   1 MPTIQQLIRSPRQKIYRRSKSPALKNCPQRRGVCTRVY-TTTPKKPNSAIRKVARVRL--TSGFEVTAYIPGIGHNLQEH 77 
12545423    1 MSTIQQLVRKRRKKIKKKKKLAALDSCPQKKCICLKVH-TITPKKPNSALRKVTRVKIisISKMFTTAYIPGIGHNLQEH 79 
11466995    1 MPTLEHLTRSPRKKIKRKTKSPALKGCPQKRAICMRVY-TTTPKKPNSALRKVTRVRL--SSGLEVTAYIPGIGHNLQEH 77 
108773420   1 MPTLQQLVRKGRIQKHTKTKTPALNNSPQKRGICIRSY-TITPKKPNSALRKVARVRL--TSKLEITAYIPGIGHNIQEH 77 
71025960    1 MTTLNQSIKRKKQN---KKKITVLNHNPQLEGFLCSII-SMSPKKPNSAKRKVGIIEL--KNNKKIKAYIPGERSVVRDK 74 
11496546    1 MLTNNQLLKHSR--IKKKKQSYNFYTKPQIKGLCIKVF-TRTPKKPNSALRKIAKIKL--KNKKEILAYIPGEGHALQDH 75 
209892891   1 MITINQLIDKGRVKKIKKTPSRALNKNPQKKCKCNAFI-VMSPKKPNSAVRKVIKTTL---NKKTVLAYVPGENVIIPKN 76 
301500889   1 MPTFEQLKRAGRFPKKRRSKTPALRGCPQKKGVCFKVF-VKTPKKPNSALRKVIRVKL--STAVFVTAHIPGEGHAVQEH 77 
301500979   1 MPTLRQIIRNGRVKIPKRRRTLALVESPQRQGVCFKVY-TMTPKKPNSALRKVVRVRL--SSRYDVIAHIPGEGYAVQDH 77 
30352097   79 SVVLVRGGRVKDLPGVRYHIVRGALDAVGV-KDRKKGRSSalqsivaTRIiaTIPY 133
215400747  78 SVVLIRGGRVKDLPGVRYHIIRGALDSASV-KNRLQGRSK-------YGT--KKPK 123
12545423   80 SMVLIRGGRVKDLPGVKYKVIRGCLDAAGV-KNRKNGRSK-------YGV--KRPK 125
11466995   78 SVVLIRGGRVKDLPGVKYHVIRGCLDAASV-KNRKNARSK-------YGV--KKPK 123
108773420  78 SVLLIRGGRVKDLPGVRYQIIRGTRDVSGV-TARRQSHSK-------YGT--KKVK 123
71025960   75 TRVLIRGGNTRDLPGVNHKIVLNMMNCRED-KPRHNKRSK-------YGV--KKIK 120
11496546   76 NFVLIKKGRVQDLPGIKYKVIRGVLDTIGV-LNRKSSRSK-------YGT--KKII 121
209892891  77 SRVLIKGGNVPDLPGVKYKVILGVLDVKRA--RRATKRSK-------YGV--KRIT 121
301500889  78 SIVLIRGGRVRDLPGVRYRLIRGTCDAQGVtKGRWNARSK-------YGV--KKPK 124
301500979  78 NLVLVRGGRVKDLPGVRFKIVRGAREAVGV-TNRKNGRSK-------YGV--KKSF 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap