Conserved Protein Domain Family
rps19

?
CHL00050: rps19 
ribosomal protein S19
Statistics
?
PSSM-Id: 176991
View PSSM: CHL00050
Aligned: 155 rows
Threshold Bit Score: 123.493
Threshold Setting Gi: 222139926
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222139926  15 AATHSKKKVFIADHLFKKIEKLDTNIKKKkILLTWSRASTVVPKMIGYTIAIHNGKEHIPIYITNNMLYHKLGDFVPTRL 94 
189095430   1 MSRSLKKGPFVAYHLLKKVQKMNELGKKE-IITTWSRSSTIIPPMLGHTIAVYNGKQHVPVFINEQVIGHKLGEFVPTRT 79 
11467467    1 MPRSLKKGPFVAYHLLKKIDKMNASGKKD-VITTWSRTSTILPTMVGHTIAVYNGRQHVPIFISDQLVGHKLGEFVSTRT 79 
118411062   1 MPRSLKKSPFVAYHLLKKINQMNKAGKKD-TITTWSRSSTILPSMIGFTIAVYNGKQHVPIFISDQLVGHKLGEFVSTRN 79 
71842318    1 MTRSLKKGPFVAAQLMDKINKMEASGKKD-SITTWSRASTILPTMIGHTFAVYNGRQHVPVFVTDQMVGHKLGEFSPTRT 79 
11467007    1 MSRSLKKGPFVFYSLIKKVDQMNSNRFKS-VILTWSRSCTIIPIMIGNTIGVYNGKEHIPVLVSDQMIGHKLGEFVQTRN 79 
11496538    1 MIKIIYRKLFIPNYFIKKSKYLYY------SIKLYYKYLIITPFLIWKLMEVYTGKSFITINITKDKIGRSLQYFC---- 70 
299830381   1 MTRSLKKSPFVAYHLLKKINQMTEAGKKDtTIKTWSRSSTILPSMVGFTIAVYNGKQHVPVFISDQYVGHKLGEFVSTRN 80 
299830602   1 MTRSLKKSPFVAYHLLKKINKMNEAGKKD-TITTWSRSSTILPSMVGFTIAVYNGKQHVPVFISDQYVGHKLGEFVSTRN 79 
118411194   1 MSRSLKKGPFVAYHLLKKINKMNADGKKD-VITTWSRSSTILPNMIGFTIAVYNGKQHVPVFISDQLVGHKLGEFVSTRT 79 
222139926  95 CpehpgKDDkkSKKDKKSSR 114
189095430  80 F-----RSH--IKSDRKSKR 92 
11467467   80 F-----KSH--IKTDKKTKR 92 
118411062  80 F-----RTH--IKADRKTKR 92 
71842318   80 F-----RSH--IKKDKKSKR 92 
11467007   80 Y-----RGHkkHDKKTKTKR 94 
11496538      --------------------    
299830381  81 F-----KTH--IKADRKGKR 93 
299830602  80 F-----KTH--IKADRKGKR 92 
118411194  80 F-----KSH--IKADKKTKR 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap