Conserved Protein Domain Family
ndhB

?
CHL00049: ndhB 
NADH dehydrogenase subunit 2
Statistics
?
PSSM-Id: 176990
View PSSM: CHL00049
Aligned: 204 rows
Threshold Bit Score: 674.411
Threshold Setting Gi: 224178041
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116617152  17 IFMKAFHLLLFDGSL-IFPECILIFGLILLLMIDSSSDQKDIPWLY-FIPSTSLVMSITALLFRW-------RE------ 81 
124112058   5 DLISSLNLIR------LLPEGIVTILLVFILLIDLTFQKRVLSWLL-YIPLVGLVCSMVVLLRQWg-----sQD------ 66 
34501378    1 -MELELDLSFFYKTT-ILPECVLIFCLISILILDLILKIKDKNVFF-FISLVSLLLSIFILIFQL-------KE------ 64 
108773217   2 YFQHQFSSLNLNS---FLPEGILIFNIIFILILDLVSQKENKSMLV-KISFIGLLLSMLTLIQQW-------YH------ 64 
11466400    1 --mefkdliaslnidaVLPEAIIICSSLFILIIDLIFQRRANAVLP-YMAILGLILSMLSLLFQWn-----gKE------ 66 
11467787    1 -MELSDILASFHASN-LIPEGIVACTILLVLLLDLVYSRTCHAWLA-WVAMAGLSLASVLLGQQWyqlmnlpTA------ 71 
22711911    3 IQNNLYGIDLYT----ILPESILIFCLLTTLIIDLSLDSKNKSWII-YLNTIGLILSGLFLCLQW-------NGi----- 65 
223931098   1 -MKLELDLSFFYGST-ILPECILIFFLLILLLLELIFEIKNKNLFF-FISLXGLFISIIILLFQL-------QE------ 64 
224178041   1 --MDFRDLILSLRAEiIFPEILLLISLLITVFLDLLFDKGSFRNIYqWLPFIGILASFTALVFQW-------EEglngsf 71 
108796789   1 --METNQLFSLDNLItILPECVLIICLLTILMIDVIT--KKSVWLS-NIALLGLLTSTFILLFQLt-----nNE------ 64 
116617152  82 -EPMISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMAITEFLLFVLTATLGGMFLCGANDFITIFVAPECFS 160
124112058  67 ---TLSFLGSFQGDSLSIAFRFFILLSAVLCILLSKEYVERSRTALTEFFVLLLTAVIGGMLLSGANDLIMIFLSLETLG 143
34501378   65 -EPVISFLGNFQADNFNKIFRIFIALCSILCIPLSIDFIKCTKLAITEFLIFLLTATIGGMFLCGANDLITIFVSLECLS 143
108773217  65 -ESTIAFLGSFEVNHFTTCFRLIISLCCILCIPLSFEYIKCSGIRLTEFIIFLLFTTLGAMILSSANDLITIFISLECLG 143
11466400   67 ---VTAFLGSFQTDSLSIAFRLLIALSSMLCVLLSIEYLENSKKTLSEFLVIFLTATLGAMLLCGSNDILMIFLSLETLG 143
11467787   72 ---TMTFGGSFQADSLSLVFRAIIAMSCVLCILLSIDYVESTGTAPSEFLVLIATASLGGMLVAGSNDLLMMFVSLETLG 148
22711911   66 -IPVTPFP-SFKGDSFSIAFRFCIIIASLLSLLLSIDYIKRAGVQLMEFVIFLLGATIGGMFLCGANDLITIFTSLECLG 143
223931098  65 -KNIISFLGSFQADNFNKIFRIFIALCSILCIPLSIDFIKCTKLSITEFLIFILTATIGGMFLCGANDLITIFVSLECLS 143
224178041  72 qDQQISFLGSLRGDELGILFRGFIALSGFFSLLLSSEYIEKSGTAKLEFYSLFVSAILGGMFLAGANDLITLFVSLETLG 151
108796789  65 -VGFTAFLGSFQVDGFTIAFRCLLTLSSALCIPLSTEYIRRSGMTQAEFLILLLTATLGGMFLCGANDLVTIFVSLECLS 143
116617152 161 LCSYLLSGYTKKDVRSNEATMKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIVNGLINT------------QMYNSPG 228
124112058 144 LSSYLLTGYMKKDLRSNEAAIKYLLIGAASSSILLYGLSLLYGLSGGAIEISTIAKNIVDK------------GLSQSFA 211
34501378  144 LCSYLLSGYTKKDVRSNEAVMKYLLIGGTSSSILAYGFSWLYGLSGGEFQLQKIADGLVST------------EMYNSFG 211
108773217 144 LGSYLLTGYVKKDIRSNEAGMKYLIIGGTSSSIFAYGLSWLYGLSGGSIYLKSIAYSFSHL------------NPSYSLA 211
11466400  144 LCSYILTGYMKKDIRSNEASIKYLLIGAASSSILLYGFSLLYGLSHGHIEIHEIAANLIKD------------QNGNSLA 211
11467787  149 LASYLLTGYMKRDVRSNEASLKYLLVGAASSGLFLYGISWMYGISGGHMELNSIAHAIVSL------------DETKTTT 216
22711911  144 LSSYLLAGYSKQDIRSNEAAMKYLLVGGASSAILAYGFSWLYGLSGGKIILSEIVDGLIFA------------DFVNPLI 211
223931098 144 LCSYLLAGYTKKDVRSNEAVMKYLLIGGTSSSILAYGFSWLYGLSGGEFQLQKIANGLLNT------------QMSNSSA 211
224178041 152 LSSYLLTGYMKRDIRSNEAGLKYLLIGAASSAILLYGISWLYGISGGHLEFHSLLASCLAF------------NLTSSVS 219
108796789 144 LSSYLLAGQAKKDIRSNEASLKYLLMGGASSSILVYGFSWLYGLSGGELQLSKIVNGISSQdiylssavsldgKTFGALG 223
116617152 229 ISIALIFITVGIGFKLSPAPSHQWTPDVYEGvrfvreiptslsisemfgffktpwtcrreilSPTPVVAFLSVTSKVAAS 308
124112058 212 SWVALIFITVGIGFKVAAAPFHQWAPDVYEG-------------------------------SPTPVVAFLSVGSKAAGL 260
34501378  212 SLLALVFIIVGIGFKLSLVPFHQWTPDVYEG-------------------------------SPTPVVAFLSVASKIAGL 260
108773217 212 SWFAYICIIVGIGFKLSLVPFHRWSPDVYEG-------------------------------SPTPVVAFLSIISKAGAL 260
11466400  212 SLVALALIIVGISFKIAAAPFHQWAPDVYEG-------------------------------APTPVVAFLSVSSKAAGL 260
11467787  217 CALALVLMTVGVGFKVAAAPFHQWTPDVYQG-------------------------------SPTPVVAFLSVGSKAAGF 265
22711911  212 KWITLTCIIVGLGFKISAVPFHQWTPDVYEG-------------------------------SPTPVVAFLSVASKTAGL 260
223931098 212 SLIGLIFITVGIGFKLSLVPFHQWTPDVYEG-------------------------------SPTPVAAFLSVASKIAGL 260
224178041 220 CWVAFFFITVGLAFKLSAAPFHQWTPDVYQG-------------------------------APTPMVAFLSVTSKAAGL 268
108796789 224 LWVAFVCILVGIGFKISAVPFHQWTPDVYEG-------------------------------SPTPVVAFLSVGSKAAGL 272
116617152 309 ASATRIFDIPFYFSSNGWHLLLEILAILSMILGNLIAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNDGYASMITYMLF 388
124112058 261 ALATRILTTLFPYLTNEWHLLFQVLASLSMILGNLIAISQTSMKRMLGYSSVSQAGFLMIGLIAGNPN-GYSSMLVYMLL 339
34501378  261 ALLVRLFNIVFPFLPNQWHSLLEISAICSMILGNLVAITQTSMKRMLAYSSISQIGYLMIGLVTGNFD-GYTSMIVYLLF 339
108773217 261 ALTIRISDIIFPILEQDSNSILQILAILSMIVGNLLAMVETSMKRILTYSSIAQAGYLLIGIVAG-RNNGYASLLVYMIF 339
11466400  261 MLATRIMTILFPYIINEWHNIFQILAILSMAIGNIIAISQTNIKRMLGYSSIAQAGFLLVGLLAGNIN-GYSSMLVYMLI 339
11467787  266 ILAVRMCTTLFPSFNTEWHLIFTILSILSMIVGNFIAVTQTSLKRMLGYSSVGQAGVMMIGMLT-DSPDGYASLIVYLLI 344
22711911  261 ALTIRIIATIFPYLENEWQFLLQILACLTMIVGNLVAITQTSMKRMLAYSSISQAGYLMIGII-SSTNDGYASSLVYMLI 339
223931098 261 ALLARFFNIVFFSFSTEWHLILEILAICSMILGNLVAITQTSMKRMLAYSSISQIGYLMIGIITGEFN-GYASMIVYLLF 339
224178041 269 ALTTRFLTLIFPYLDPEWHFFFEILACLSMGIGNLVALTQTSFKRMLGYSSVGQAGYLMIGLITGE-EEGYASLLIYLFV 347
108796789 273 ALATRLLSIVFPAIEDQWHIVLEIVAFLSMVFGNLIAATQTSMKRMLAYSSISQAGYLLIAILVGNSD-GYASMITYLLI 351
116617152 389 YISMNLGTFACIVLFGLRTGTDNIRDYAGLYTKDPFLALSLALCLLSLGGLPPLAGFFGKLYLFWCGWQAGLYFLVLIGL 468
124112058 340 YIFMNLGAFACIILFGLKAGTDQIRDYAGLYRKDPFLVFCFSISLLSLGGIPPLAGFFGKLYLFWSGWQSGFYILVFIGL 419
34501378  340 YIFMNLGTFACIILFGLRTGTDNIRDYSGLILKDPLLTFSLALCLLSLGGIPPLSGFFGKLYLFWCAWKTGLYFLVFIGL 419
108773217 340 YLFMNIGAFSCIILFGLRTGTDQIRDYTGLYTKDPWLASCLSLCLLSLAGIPPLTGFFGKILLFWSAWQSGFYFLVMTGI 419
11466400  340 YLFMNLGAFACVILFSLKTGSDQIRDYGGLYLKDPILALCLSICLLSLGGIPPFGGFFGKLYLFWAGWEAGSYLLVFVGL 419
11467787  345 YLFMNLGAFACVILFGLRTGTDQIQDYSGLLARDPFLALCLSLCLLSLGGIPPLAGFFGKMYLFLAAWDAGQYSLVWVGL 424
22711911  340 YIFMNLGAFGCVILFGLRTGTDQIRDFSGLYLKDPWLASCLTIFLLSLGGIPPFAGFFGKIYLFWSGWQAGLYILTFVGL 419
223931098 340 YIFMNLGTFACIILFGLRTGTDNVRDYSGLILKDPLLTFSFAVCLLSLGGIPPLSGFFGKLYLFWCAWKAGLYFLVFIGL 419
224178041 348 YLLMNLGAFSGAILFGLRTGTDQIKDFSGLYKKDPALAAGLSVALLSLGGIPPLAGFFGKIYIFWAGWKAGYFFLITFAL 427
108796789 352 YTFMNLGAFACTVIFGLRTGTDQIRDYTGLYLKDPWLAFALSICLLSLAGMPPLAGFFGKLYLFWCGWQSHLYLLVYTGL 431
116617152 469 LTSVVSIYYYLKIIKLLMTGRNQEITPHVRN---YRRSP--LRSNNSIELSMIVCVIASTIPGISMNPIIAIAQDSL--- 540
124112058 420 FTSVISIYYYLRVIKVMIVTEPQEMSIYVQRy-tQRRWS--ITQLQPIELGIGLCVLGSVLAGVLVNPIINIAQQTV--- 493
34501378  420 FTSVISIYYYLKIIKLLITTENKEVTSYVQS---YTVSSfsLLSKNSIEVSIIICVIASIFLGIFMNPIINILQINL--- 493
108773217 420 FTSIVSIYYYIRIVKFLVVAKEKDISYYVKKystYKSNS--LMKQNPIELNIYLCTFISGFVGIFMNPVIYFAQQSIlk- 496
11466400  420 LTSVISIFYYIKIIKMMIIKESPEVSFAIKNy-sQKRWS--IKDITPIEVSILICVIGTTISGIFVNPIISIAQQTVids 496
11467787  425 ITSVVSIYYYLSVVKIMLVPATQEMSLAVREy-pRRAWS--LEPIQPLEVGIFVCVLGSILVGVAGNSMVNLMTITMsqa 501
22711911  420 LTSVISIYYYLRIIKIMFVREAKEFSSYVKN---YVIPVnsLLPQSSVETAMIVCMIASSVMGIAINPIIQVAQKTIlst 496
223931098 420 STSIISIYYYLKIIKLLITTENKKMTFYIQT---YKVSSlfLLSKNSIEVIIIICVIASLFLGIFMNPIINLLQSFLnln 496
224178041 428 VTSVISIYYYLRVVKIMFVKDSLSLINYPISf--FPKKP--------IEFGMSFCTFGSLFVGIFLNPILEGVERSL--- 494
108796789 432 ITSVISLYYYLRVVKAMMTKEVKEMSTYVRE---YVTPSmsIFSSSSIELGLTLCVLASSILGFFMNPLIDVTKQSM--- 505
116617152 541 --F 541
124112058 494 --L 494
34501378  494 --H 494
108773217     ---    
11466400  497 swl 499
11467787  502 psl 504
22711911  497 ipf 499
223931098 497 sfI 499
224178041 495 --E 495
108796789 506 --L 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap