Conserved Protein Domain Family
atpI

?
CHL00046: atpI 
ATP synthase CF0 A subunit
Statistics
?
PSSM-Id: 176987
View PSSM: CHL00046
Aligned: 173 rows
Threshold Bit Score: 267.185
Threshold Setting Gi: 301500898
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500898   1 MFL-NFSIAVHYCWNICNFTFHGETLLMQWLFFSLFNYFFLRYWYQYDfyiCKNKGFnlISFFWAYITFryfykqqntnL 79 
11467511   12 TLLaEAEVGKHFYWDIAGFLVHGQVLVVVWFVLALLLLFAVLGTRDID---RIPNSW--QNFAESAVDF----------V 76 
118411026  12 TLLaEAEVGKHFYWNIAGFLVHGQVLAVMWFVILVLLIFSLLGTLNAD---RIPHDF--QNFMEASVDF----------V 76 
215400709  33 LLLsEVEVGKHFYWEIRGITLHGQVFIVSWFVIFLILLFTFLGTSNIQ---KIPSNF--QNFMESVVEF----------T 97 
242620029   8 ilLaGVEIGTHYYWDIAGFAIHGQVFIVSWVVIGLLLTAAFLGANDPK---RIPESW--QNFMEATVEF----------T 72 
242624343   8 ilIaGVEIGTHYYWNVGGLALHGQVFIVSWVVIGFLLIASILGAKDPK---RIPESW--QNFMEATIEF----------T 72 
299830361  12 TLLaDAGVGKHFYWDLAGFLVHGQVLVVLWFVIAVLVLLSVLATSNAE---RIPHGF--QNFMEVAVDF----------V 76 
299830564  12 TLLaEAEVGKHFYWDLAGFLVHGQVLVVIWFVVLILLILSFLGTSNAE---RIPHGF--QNFMEAAVDF----------V 76 
301500933   6 liseGIAVGGQYYWFISGLKLHGTVILSILITIAPLLVLTGLA----------RVGG--KGFLNALETLwspfqisfktV 73 
118411107  12 TFLaEAEVGKHFYWNIAGFLVHGQVLVVIWFVVLLLLIFSFLGTREAD---RIPHSW--QNFMESALDF----------V 76 
301500898  80 NLLHPCNMG--EAFIWSTYIFVWFSFIFFENWVGVIFPKFLFHLPLVDLTAATADINTTVGLALLVVISSFYQRYKTEGI 157
11467511   77 TDIARDQLGesFYREWVPFIGTLFLFIFGCNWAGAIIPWKLIELPEGELAAPTNDINTTVALALLTSLAYFYAGLSKKGF 156
118411026  77 TDIARDQLGesFYKEWIPFIGTLFFFIFGSNWAGAVIPWKLIELPEGELAAPTNDINTTVALALLTSFAYFYAGLSKKGL 156
215400709  98 KKIAVNQLGhsEYRPWLSFIGTLFLFILGCNWAGALIPWKLIKLPEGELSAPTNDINTTVALALLTSGTYFFAGLQKKGI 177
242620029  73 QDIARNQLGesSYRTWLPFVSTMFLFIFGCNWAGAIIPWKLILLPEGELAAPTNDINTTVALALLTSLTYFYAGFRKKGL 152
242624343  73 QDIARNQIGenGYRTWLPFVSTLFLFIFGCNWAGAIIPWKLILLPEGELAAPTNDINTTVALALLTSLAYFYAGFRKKGL 152
299830361  77 TDIAKDQLGesFYKEWIPFVGTLFFFVFGCNWAGAIIPWKLIELPEGEFAAPTNDINTTVALALLTSFAYFYAGLSKKGF 156
299830564  77 IDIAKNQLGesFYKEWIPFIGTLFFFIFGCNWAGAIIPWKLIELPEGEFAAPTNDINTTVALALLTSLAYFYAGLSKKGL 156
301500933  74 NNILVSCLGrkYVRPWRPFFIIVYIQILLWNWN-IILPLKLITLPGAEFVSPSTDINVTVALALMVSIAYFYAGIRRKGL 152
118411107  77 VDIARNQLGesFYREWIPFIGTLFLFIFGCNWAGAVIPWKLIQLPEGEFAAPTNDINTTVALALLTSFSYFYAGLSKKGL 156
301500898 158 WFVKNYLEPLPLLLPLNIVEEFTKPLSLSFRLFGNILADELTGLVITSLIPLGIPIPLIALGLFAGYIQTIIFINLTFDY 237
11467511  157 GYFKRYIQPIPLLLPINILEDFTKPLSLSFRLFGNVLADELTITVLTSLVPLVIPLPIMALGIFAGSVQALIFSTLAAAY 236
118411026 157 GYFKRYIEPLPLLLPINILEDFTKPLSLSFRLFGNVLADELTITVLTSLVPLVIPLPIMLLGVFAGSVQALIFSTLAAAY 236
215400709 178 GYFKRYLQPTPVLLPINILEDFTKPLSLSFRLFGNILADELTVTVLTMLVPLIIPLPIMVLGVFASSIQALIFSTLAAAY 257
242620029 153 GYFKRYLEPTPILLPINILEDFTKPLSLSFRLFGNVLADELTISVLVLLVPLFIPLPIMALGIFAGSVQALIFSTLAAAY 232
242624343 153 GYFKRYLEPTPILLPINILEDFTKPLSLSFRLFGNVLADELTISVLVLLVPLFIPLPIMALGIFAGSVQALIFSTLAAAY 232
299830361 157 GYFKRYVQPIPLLLPINILEDFTKPLSLSFRLFGNVLADELTITVLTSLVPLVIPLPIMLLGIFAGSVQALIFSTLAAAY 236
299830564 157 GYFKRYVQPLPLLLPINILEDFTKPLSLSFRLFGNVLADELTVTVLTSLVPLVVPLPIMLLGIFAGSVQALIFSTLAAAY 236
301500933 153 GAFRRYIKPTPILLPINLLEDFAKPLSLSFRLFGNVLADDLTVAVFSLLVPLIIPLPIIALGVFAGSVQAVIFTTLAAGY 232
118411107 157 GYFKRYVNPIPLLLPINILEDFTKPLSLSFRLFGNVLADELTVTVLTSLVPLVIPLPIMLLGIFAGSVQALIFSTLAAAY 236
301500898 238 IFE 240
11467511  237 IAE 239
118411026 237 IAE 239
215400709 258 ISE 260
242620029 233 IHE 235
242624343 233 IHE 235
299830361 237 IAE 239
299830564 237 IAE 239
301500933 233 IEE 235
118411107 237 IAE 239
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap