Conserved Protein Domain Family
rpl16

?
CHL00044: rpl16 
ribosomal protein L16
Statistics
?
PSSM-Id: 176985
View PSSM: CHL00044
Aligned: 169 rows
Threshold Bit Score: 207.826
Threshold Setting Gi: 237688554
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329692   1 MLSnPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRNVRRGGKIWVRIFPDKPVTLRPT 80 
7524927     1 MLS-PKRTKYRKHHRGRMRGKASRGNTVVFGDYALQSLEASWITSRQIEAARRAMTRQVRRGGQIWIRLFPDKPVTMRPA 79 
11467773    1 MLS-PKRTKFRRPHRGHRRGRALRGNTIAFGDFAIQALESSWVTSRQIEAARRAMTRYARRGGKIWIRIFPDKAITMRPA 79 
224179440   1 MLS-PKRTKFRRYHRGRMRGRTLRGNKPVFGNFALRATECSWVTSRQLEAGRRAITRYVRRGGKLWIRVFPDRPITMRPA 79 
224178077   1 MLS-PKRTKFRRYHRGSLKGTSGRGNTVSFGEFGIQALEAGWITSRQIEAGRRVMTRYARRGGKLWIRIFPDKPITMRPA 79 
224179522   1 MLS-PKRTKYRKHHRGRMKGQASRGNKIAYGTFALQALEPGWLTSRQIEAGRRTITRYAKRGGKLWIRVFPDKPITMRPA 79 
226968559   1 MLS-PKRTKYRKPHRGRLTGKAMRGNKIAFGDFALQALEPGWITSRQIEAGRRAMSRYARRGGKLWIRVFPDKSITARAA 79 
226968671   1 MLS-PKRTKYRKPHRGRLKGQAMRGNKISFGDFGLQALEPGWITSRQIEAGRRAMSRYARRGGKLWIRVFPDKSITARAA 79 
113170447   1 MLS-PKRTKYRKPHRGNRKGQALRGNKISFGDFALQALEPGWITSRQIEAGRRAMSRYAKRGGKLWIRMFPDRSITARAA 79 
115443550   1 MLS-PKRTKFRRYHRIRSKGTANCSNTIVFGEFGIQALTCSWITSRQIEAGRRAITRYVKRGGKLWIRIFPDKPITFRPP 79 
114329692  81 ETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISIAASKMPIRTQFIISG 136
7524927    80 ETRMGSGKGAPEFWVAVVRPGKVLYELKGVPESVARVALRLAASKLPVKTQILVK- 134
11467773   80 ETRMGSGKGSPEYWVAVVKAQKILFEMKGVPETIARASMRIACFKMPMKTRILQR- 134
224179440  80 ETRMGSGKGAPEYWVAVVRPGRIIYEIDGVSESVARAAMRLAAYKMPMKTQFVSRM 135
224178077  80 ETRMGSGKGAPDYWVAVVKPGKILFEIAGVPEPIARSAMRIACYKMPVKTRIITKV 135
224179522  80 ETRMGSGKGSPEYWVAVIKPGRILYEMNGVPLTLAKEAMRNASYKMPVKTTFLTTI 135
226968559  80 ETRMGAGKGAPDYWVAVVKPGKILYEMRGVSEAIARSSMRIAAYKMPVKTKFLIRE 135
226968671  80 ETRMGAGKGAPDYWVAVVKPGKILYEMRGVSEAVARSSMRIAAYKMPVKTKFIIRE 135
113170447  80 ETRMGAGKGAPDYWVCIVKPGKILYELAGVPETIARASMRIAAYKMPVKTKFLVRD 135
115443550  80 ETRMGSGKGAPELWVSVVRSGNMLYEILGVSEVTARGAMRIASYKLPVKTKFIKKV 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap