Conserved Protein Domain Family
petA

?
CHL00037: petA 
cytochrome f
Statistics
?
PSSM-Id: 176978
View PSSM: CHL00037
Aligned: 168 rows
Threshold Bit Score: 332.27
Threshold Setting Gi: 301500849
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218176255   1 MENKNTFS--WVKEQMTRSISVSIM--IYV-ITQTSISNAYPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVL 75 
118411009   1 ----------MATNKFFKSLLFALTiaINSfGFCIQDAVAYPVFAQQNYSNPRAANGKLACANCHLNQKAIEIEAPQAVL 70 
269101116   1 ---MELL------KRLMKFFIISFIfvISSiPFSMEMSEAYPIYAQQGYTNPRAANGRIACANCHLAEKPVQIESPKAVL 71 
215400701   1 ---MIKFKhkTILLKISKILLISVLliFNTlNISLDQAQAYPIYAQQAYTNPRAANGKIACANCHLAEKPIGIETPQAVL 77 
242620115   1 --MKKQF------KTLICSISAAFM--VFG-NLLPETAQAYPIYAQQAYANPREANGRIACANCHLAQKPTAIESPSAVL 69 
242624352   2 NKILKQF------------IYLCSTgfIFSaCSFNGLVNAYPIYAQQAYSNPREANGRIACANCHLAQKPVSIESPSAVL 69 
299830343   1 ----------MATNKFFKSLFFALTiaINVfGFSAQESSAYPVFAQQNYSNPRAANGKLACANCHLNQKAIEIEAPQAVL 70 
299830548   1 ----------MATNKFFKSLLFALTiaINVfGLSVQESSAYPVFAQQNYSNPRAANGKLACANCHLNQKAIEIEAPQAVL 70 
301500943   1 -------------------MTMSVN-----------FDLSFPIYAQQAYANPREANGRIVCANCHLAAKPVEVETVQAVF 50 
118411137   1 ----------MATNKFFKSLLFTLTiaISSfGFCVENSSAYPVFAQQGYSNPRAANGKLACANCHLNQKAIEIEAPQGVL 70 
218176255  76 PDTVFEAVLRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAPPDRISPELKRKVYgNLSFQSYRPDKKNILVIGPVP 155
118411009  71 PNSIFEVEIKVPYDTTKQQLGANGKKADLNVGGILMLPEGFKLAPKNQIPAEVKEKNK-GVFISPYSSEFDNILVVGPIA 149
269101116  72 PNKVFEAAVKIPYSKDAKQILGNGQLSGLNVGAVVILPEGFKLAPNNLISKEIKEKSK-GVFISPYSATQENILVVGPIA 150
215400701  78 PDSVFEANIKIPYDKTIQQIQGNGKYGDLNVGAVLILPEGFKLAPKDKISSEIKEKNK-QLYISPYSSTQENILVVGPVS 156
242620115  70 PDTVFEAIVKIPYDVSKKQLVASGDRGPLNVGAVVILPDGFKLAPPSRVPSEVKAKNK-GVYISPYSSKSENILVVGPIL 148
242624352  70 PDTVFEAVVKIPYDVSKKQLLANGDRGPLNVGAVVILPEGFKLAPPSRISSEIKAKNK-GIYISPYSSKAENILVVGPIL 148
299830343  71 PNSVFEVEIKVPYDTSKQQIGANGKKADLNVGGILILPKGFKLAAKSQISDEVKAKNK-GVFISPYSTEFDNIFVVGPIA 149
299830548  71 PNSVFEVEIKVPYDTSKQQIGANGKKADLNVGGILILPKGFKLAAKNQISEEVKLKNK-GVFISPYSTEFDNIFVVGPIA 149
301500943  51 PDSSFAVKVTVPYPQNAEQLLGDGSKGPVGVGAVVILPEGFKLAPADRTPKDARF----SNSVIPYGPEADNILVVGPVY 126
118411137  71 PNSVFEIEIKVPYDVNRQQISADGKPADLNVGGILILPKGFKLASKTQISPEVKAKNK-GVFISPYSTEFDNILVVGPIA 149
218176255 156 GKKYSEIVFPILSPDPATKKDAYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVKKILRKEKGGYEISIVDASD 235
118411009 150 GKTHQELIFPVMAPDPEKNSDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGANQSGQITEITVTEKGESTILILN-SN 228
269101116 151 GDTHQEIIFPVLSPDPATNKKINFLKYPIYVGANRGRGQIYPTGEKSNNNIVTSSFEGQVIDIQTLAKGETEVTMVN-SK 229
215400701 157 GNLYQEIIFPILAPNPETNKNVHFLNYPIYVGGNRGRGQLYPTGDKSNNNPINAKVNGQILKINSTEKNETKINIL-TND 235
242620115 149 GDKNREIAFPVLSPDPAKDPKVKFLKYPIYVGANRGRGQINPNGDKSNNNPVLAIAPGLISAVDQDAKSGSTTVAITAPD 228
242624352 149 GDKNREITFPVLAPDPE-KSDAKYLKYPIYVGANRGRGQINPNGEKSNNNPILSSVVGQVTEIRTNENGTSDISI-KTND 226
299830343 150 GKTHQELLFPVVAPDPEKNSDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGATQAGQITEITTSEKGESNVVIV-SSS 228
299830548 150 GKTHQELLFPVVAPDPEKNPDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGASQAGQITEITTSEKGDSTIVIVN-SN 228
301500943 127 GEANRELYFPVVSP----SDDALGQKYTIYVGANRGRGQVNPNGDKTNNNLVTAPANGEITDVQRKPNGECVISL-KTGS 201
118411137 150 GKTHQELIFPVVAPDPENNPDVKYLTYPFYAGGNRGRGQVYPTGERSNINSFGATQGGQITEITTTEKGESKITIVN-SD 228
218176255 236 GRQVIDTIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGECkKIVLQESItRSKPFCSSSHPLFWHKFFWFSKRNSLKR 315
118411009 229 GKQTSQVLPAGLILSIKQGQVVKADQPLNIDPNVGGFGQEES-EIVLQNPI-RIYGYLAFCFSVLITQIMLVLKKKQFEK 306
269101116 230 GNETKQNIPKGLSVVVSKKDNIKLDQPLTKDPNVGGFGQTDV-EIVLQDPS-RVVGFIIFAFSVLFTQIFFVIKKKQFEK 307
215400701 236 NKEIEQIIPKGLTVLVKENDIIQLDQPLTKDPNVGGFGQTET-EITLQNPI-RVLGYMAFVLTILTTQILLILKKKQFEK 313
242620115 229 GTITEQKISKGLNVIAKPGQAVTKDTLLTTDPNIGGFGQAET-EIVLQNPD-RIIGYLVFCLAVVLCQIFLVIKKKQFEK 306
242624352 227 GSIIDEKIYKGLTVSVKPGQKVTKDTPLTFDPNVGGFGQTET-EIVLQNSN-RIIGYLVFCLAVVLCQIFLVIKKKQFEK 304
299830343 229 GAKTSQIVPAGLELIVKAGDVVQTEQALNLDPNVGGFGQEES-EIVLQDPA-RIVGYLAFCFCVLLTQIFLVLKKKQFEK 306
299830548 229 GTKTSQIIPAGLDLMVKTGEIVKADQALNVDPNVGGFGQEES-EIVLQDPA-RIVGYLAFCFCVLVTQILLVLKKKQFEK 306
301500943 202 GDTLTQKVPRGIDLAVSKGQLVKVDQPLTLDPNIGGFGQSEA-GIVLQKKN-RLVGLFIFCVGITLAQIFLVLKKKQYER 279
118411137 229 GATTSQTLSAGLKLLVKQGDIVKQDQPLNIDPNVGGFGQEES-EIVLQSSS-RILGYLAFCFCLLLTQVLLVLKKKQYEK 306
218176255 316 FSCTKMNF 323
118411009 307 VQAAELNF 314
269101116 308 VQAAELKF 315
215400701 314 VQASELNF 321
242620115 307 VQAAEMNF 314
242624352 305 VQAAEMNF 312
299830343 307 VQAAELNF 314
299830548 307 VQAAELNF 314
301500943 280 VQLWSM-- 285
118411137 307 VQAAELNF 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap