Conserved Protein Domain Family
ycf4

?
CHL00036: ycf4 
photosystem I assembly protein Ycf4
Statistics
?
PSSM-Id: 176977
View PSSM: CHL00036
Aligned: 152 rows
Threshold Bit Score: 203.514
Threshold Setting Gi: 115443556
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153805575  19 FLKKQPEIRRYIIQGSRRFSNYWWAFIVCLGSIGFLLTGISSYFEfq--------------nlLHLQNYFSfaneaqssl 84 
41179038    1 MTQNNILIRRYIIVGERRFSNYWWAIVIFLGSCGFLATGICSYLGi-----------------PNWLSLLNigttfsset 63 
108773098   1 -MNQENFIRRYFIIGERRFSNYWWATVILIGSFGFLLTGISSYIStslnstalssniesqmqlPFFLSMLKns------- 72 
124112130   6 IDSKSDLIRRDPVLGSRRLSNYWWATVILVGASGFFLVGISSYFG------------------FNLVPFIK--------- 58 
108773347   1 --MSEELIRRYSITGSRRFSNYWWSSVIFLGASGFLLTGLSSYLN------------------VNLLPFIH--------- 51 
108796953   1 --MKPDSIRRYNVIGSRRISNYWWAIIIGSGGLGFLFTGLSSYLQ------------------FNLLPIIH--------- 51 
11467801    1 -MDTTNLVRRDIVIGSRRVSNYWWASVLLLGGSSFLVVGLSSRLG------------------FDLVPFLP--------- 52 
194033327   2 NNTNTNRIRRYVILGSRRFSNYWWASVIFLGALGFTLTGISSYLK------------------SDLVPFLQ--------- 54 
115350024   1 -MNSENLIRRYVITGSRRLSNYWWASVVFLGAIGFLFTGLSSYFG------------------QNLLPFLQ--------- 52 
115443556   1 --MENVFIYRYTVLGSKKISNLIFAIFIFLGSIFFLKASIFSFLD------------------LKTNSL----------- 49 
153805575  85 nkveLPIILFFPQGLVMCFYGILGLFLSFYLWFSIFLNIGAGFNEIYIYTGetlktenqysksinsnnlkannwnsskik 164
41179038   64 etlaSGIVPFFPQGLLMSFYGSLGFLLSIYWSLLIFWNVGGGFNEFNKKEG----------------------------- 114
108773098  73 --nsTGAINFFPQGLLMCFYGSLGFLLSIYWWCLIFWNVGGGFNEFNKKEN----------------------------- 121
124112130  59 ----SEEILFIPQGLVMSFYGVAGILLSVYLWLTIIWNVGEGYNEYNKQDG----------------------------- 105
108773347  52 ----AENIIFFPQGLVMCFYGILGLIFSVYLGLTIFWSVGSGFNEFNKKDG----------------------------- 98 
108796953  52 ----AEKIIFFPQGLVMSFYGILGIFFSLYLGLTILFSVGEGFNEFNKELG----------------------------- 98 
11467801   53 ----AGDIIFIPQGLVMCFYGLVGLVVSTYLWLTILWSVGGGYNEFNKQEG----------------------------- 99 
194033327  55 ----SKEIVFFPQGLVMSFYGILGLLLSIYLWLTILWNVGGGFNEFNKKEG----------------------------- 101
115350024  53 ----VQNITFFPQGLVMSFYGILGLLLSIYLWLTIIWNVGGGFNEFNKKAG----------------------------- 99 
115443556  50 ----NGNIVFFPQGLVMGFYSLLGLLFTFYSLLTFFLKIGFGYNEFNKKEN----------------------------- 96 
153805575 165 snlkkftkmkdtqtidyssenelknqltnpnsavckfakggsevgcweqsaltplpptplsHIRIFRWGFPGKNRKINLQ 244
41179038  115 -------------------------------------------------------------FVRIFRWGYPGKNRKIDLS 133
108773098 122 -------------------------------------------------------------FIRIFRWGYPGKNRKIDLY 140
124112130 106 -------------------------------------------------------------IVRIFRWGFPGKNRRIDLV 124
108773347  99 -------------------------------------------------------------LVRIFRWGFPGKNRRIDLS 117
108796953  99 -------------------------------------------------------------IIRIFRWGFPGKNRRIDLS 117
11467801  100 -------------------------------------------------------------VMRIFRWGFPGRDRRIQLT 118
194033327 102 -------------------------------------------------------------FLRIFRWGFPGKKRFIDIK 120
115350024 100 -------------------------------------------------------------AIRIFRWGFPGKTRCIDIS 118
115443556  97 -------------------------------------------------------------VIRIFRWGFPGKNRRIEAC 115
153805575 245 YSIDQISAIKLEFLQGFNSKRTICLKLSDQREILLTgsPQGDWETFEQLEKQASELAKFLKVNLEFS 311
41179038  134 YSLKDIEAIRVELKQGLDAQRTIYLRLKGKREIPLT--GIGQPLTLKEIEKQASELANFLQVSLEA- 197
108773098 141 YTLKDVESIRVEILQGFDSQRTIFLKLKGNREIPIT--GIGQPLTLQEIEKQASELANFLQVSLEGL 205
124112130 125 YPIQDVQAIRVEIKEGINPRRVIYLKIKGKREIPLT--RIGQPLTLGEIEEKAANLARFLQVSIEGL 189
108773347 118 YALTDVEAIRVELQEGINPRRTIYLCVKGNREIPVT--RIGQPMSLEEVETQAAELAKFLQIDLFLK 182
108796953 118 YSIDDVKAIRVELKDGINPKRTIYLCIKGQRQIPLT--RVGQPLTLEEIEMQAAELAQFLQKDLLLN 182
11467801  119 CPLQDIEAIRVELQEGMNPRRTIYVRLKGKREVPLT--RIGQPLTLAEIEKQAAELAGFLQVSLEGF 183
194033327 121 YPLNEIEAIRIELKQGINPKQTIYVRIKGKRDIPLN--QIGQPLTIEEIEKQAAELAQFLQVSVDGL 185
115350024 119 YSLKEVEAIKVDFKQGVNPQRTLYLRVKGKREIPLS--QIGQPLTVEEVEKQAAELAKFLQVSVEGL 183
115443556 116 YSINDIKSIKISSNTGP---KNISISLKGDIDIPFI--REGFSDSFSNIEEQAIDIASFLGIPLVYN 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap