Conserved Protein Domain Family
ycf3

?
CHL00033: ycf3 
photosystem I assembly protein Ycf3
Statistics
?
PSSM-Id: 176974
View PSSM: CHL00033
Aligned: 165 rows
Threshold Bit Score: 264.562
Threshold Setting Gi: 118411133
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329657   1 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDGMSAQSEGNYAEALQNYYEAMRLEIDPYDRSYILYNIGL 80 
11467562    1 ------MSNFIDKTFTVIADILLKVLPASKQEKQAFSYYRAGMSAQSEGKYAEALENYYEALQLEEDPYDRSYTLYNIGL 74 
118411013   1 ------MGNFIDKTFTVIADILLKVLPASKQEKEAFSYYRAGMSAQSKGRYAEALQNYYEALQVEEDPYDRSYTLYNIGL 74 
71842285    1 --MSQKNDNFIDKTFTVLADILLKVLPATKEEKKAFSYYRYGMSAQSSGDYAEALENYYEALKLEEDPFDRSYILYNIGL 78 
11467695    1 MPRFQKNDNFIDKTFTVLADLVLKILPATKQEKEAFSYYRDGMSAQSEGEYAEALENYYEALRLEEDPYDRSYILYNIGL 80 
149071995   1 MPRFQKNDNFIDKTFTVLADIVLKVLPASKQEKEAFSYYRDGMSAQSEGEYAEALENYYEALRLEEDPYDRSYILYNIGL 80 
242624336   1 MSRSQRNDNFIDKTFTIIADILLKVFPASKQEKEAFSYYRDGMTAQSQGDYAEALENYYEALQLEEDPYDRSYILYNIGL 80 
299830347   1 ------MGNFIDKTFTVIADILLKVLPASKEEKQAFSYYRAGMSAQGKGRYAEALQNYYEALQVEEDPYDRSYTLYNIGL 74 
299830552   1 ------MGNFIDKTFTVIADILLKVLPASKQEKQAFSYYRAGMSAQGKGRYAEALQNYYEALQVEEDPYDRSYTLYNIGL 74 
118411133   1 ----MGVRNFIDRVFTVISDLILKLLPASKQEKQAFAYYKAGMAAQAEGDYAEALENYYESLYLDEDQYDRSYTLYNIGL 76 
114329657  81 IHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYRGEQAV---RQGDS---------------EIAEAWFNQAAEY 142
11467562   75 IYGNNGNYSQALEYYHQALELNSNLPQALNNIAVIYHSQGLNALqmqNQDKNleirn------deylELAKEFFDKAAEY 148
118411013  75 IYGNTGKYTQALEFYHQALSLNANLPQALNNIAVIYHSQALRAQ---SLEEDey------------iELSKELFDKAAEY 139
71842285   79 IYGNNGDYSKSLDYYHQALDLNSRLPQALNNIAVIYHYQGTKSS---EKKEF---------------EVAQNNFDKAASY 140
11467695   81 IYASNGEYVKALEYYHQALDLNSQLPAALNNIAVIYHYQGVKAS---EKKEL---------------DLARTLFDKAAEY 142
149071995  81 IYASNGEYIKALEYYHQALDLNSRLPPALNNIAVIYHYQGVKAS---EKKDL---------------ETARTMFDKAAEY 142
242624336  81 IYSNNGEYIQALEYYQQALDLNANLPQALNNIAVIYHYQGTQAA---ERQNT---------------EVAKNLFDKAGEY 142
299830347  75 IYGNTGKYTQALEFYHQALALNSNLPQALNNIAVIYHSQALRAQtleEDEYT---------------ELSKELFDKAGEY 139
299830552  75 IYGNTGKYTQALEFYHQALALNSNLPQALNNIAVIYHSQALRAQtleEDEYT---------------ELSKELFDKAGEY 139
118411133  77 IYAKNENYPRALEYYHQAVSLNSNLPQALNNIAAIYHRQGLLAL---EMASQdydaemeiseeyeyiELAKGLFDKAAEY 153
114329657 143 WKQAIALTPGNYIQAQNWLKITGRFE 168
11467562  149 WRQALKLAPDNYPGAQNWLKVTGRQI 174
118411013 140 WIQALKLAPDNYPGARNWLKVTGRLS 165
71842285  141 WKKAIRLAPNNYIEAQNWLKITGKLS 166
11467695  143 WKQAIRLSPNNYIEAQNWLKTTGRSD 168
149071995 143 WKQAIRLAPNNYIEAQNWLKTTGRMA 168
242624336 143 WCQAVRLAPNNYIEAQNWLKTTGRMS 168
299830347 140 WIQALKLAPDNYPGARNWLKVTGRLR 165
299830552 140 WIQALKLAPDNYPGARNWLKVTGRLR 165
118411133 154 WYQALKLAPDNYPRARNWLRITGRAK 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap