Conserved Protein Domain Family
ndhC

?
CHL00022: ndhC 
NADH dehydrogenase subunit 3
Statistics
?
PSSM-Id: 176964
View PSSM: CHL00022
Aligned: 118 rows
Threshold Bit Score: 177.102
Threshold Setting Gi: 11466707
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34501410    1 MFLLPKYNSFFIFLLLASVIPILAFSISKFLAPNNtQGPEKLTSYESGIEPMGDAWIQFQIRYYMFALVFVIFDVETVFL 80 
255961310   1 MLSILEYNSFLLSPLIASSAPLVAYPIPGTAAPVS-RGPEKFIGHESGMEPTGDTRTKFQIRYYMFAPVPVILDVETVFP 79 
49574599    1 MFLSHQYDSFWIFLLVCISIPLLAFSITRFAAPPR-EGPEKSTSYESGIEPKGDTWIRFQIRYYMFALVFTVFDVETVFL 79 
11467815    1 MMILEGYGSVLAFFVIASLIPVIALSASKLLRPRG-GGPERRTTYESGIEPMGEAWIQFNIRYYMFALVFVVFDVETLFL 79 
108796790   1 MPILPKYESFWAFLLIACLIPVLAISVSNLVAPSTsKNPEKSTTYESGIEPMGESWIQFQIRYYMFALVFVIFDVETVFL 80 
301353379   1 MFSLHQYDSFRIFLLVSISIPYLAFSIPRFIAPTR-KGPEKLTSYESGIEPKGDTWIRFQIRYYMFALVFTVSDVETVFL 79 
224178042   1 MFVLNEYTYVFLFFVIACLVPILALTTSKLLRPEG-VGPERRTTYESGIEPMGEARIQFNIRYYMFALLFVLFDVETLFL 79 
108796688   1 MYTLAGYESFWAFLLIASLVPVLAVGTSSLVAPSS-KAAEKRTSYESGIEPMGESWIQFQIRYYMFALVFVVFDVETVFL 79 
22711912    1 MIVFSKYKTFWFFLIIGAIIPTLAFTTSKLLAPTV-TTPEKKTSYESGIEPIGEAWIQFQIRYYMFALVFVIFDVETIFL 79 
242910150   1 MFLLHKHDSFWIFLLISISIPYLAFLIPRLLAPIR-EGPEKLASYESGIEPKGNTWIRFQIRYYMFASVFAISDVETVFL 79 
34501410   81 YPWAMSFNDLGLSAFIEALVFVFILIIGLVYAWRKGALEWS 121
255961310  80 HPWATSFNELGIFASIEAFTSVTIPVVGSVYAWRKGALEWS 120
49574599   80 YPWATSFEELGLFAFVEVIVFIFILIVGLVYAWRKGALEWC 120
11467815   80 YPWAVTFQRLGLSAFFEVLIFIIVLLIGLVYAWRKGALEWS 120
108796790  81 YPWAMSFDDLGIIAFAEVLVFVIILIIGLIYAWRKGALEWS 121
301353379  80 YPWAIAFRELGLFAFIEVIIFIVILIVGLVHAWRKGASEWS 120
224178042  80 YPWSVTFRQLGLSAFLEALVFVCILILGLVYAWRKGALEWS 120
108796688  80 YPWAMSFQQLGVLAFIEALVFVLVLIIGLVYAWRKGALEWS 120
22711912   80 YPWAMSFDQLGVYGFIEALIFVLILVIGLVYAWRKGALEWS 120
242910150  80 YPWAIGFRELGLFAFIEVIILILILIVGSVHAWRKGALEWS 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap