Conserved Protein Domain Family
psbN

?
CHL00020: psbN 
photosystem II protein N
Statistics
?
PSSM-Id: 176963
View PSSM: CHL00020
Aligned: 144 rows
Threshold Bit Score: 57.3925
Threshold Setting Gi: 194033297
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329683  1 METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD 43 
7524845    2 DSPAFFFTIFLWCLLLSITGYSIYVGFGPPSQQLRDPFEEHED 44 
108773061  2 DSPAFFFTFFLWFLLLSATGYSIYVSFGPPSKKLRDPFEEHED 44 
108773365  2 ESPAFFFTIFLWCLLLSVTGYSVYVGFGPPSKDLRDPFDEHED 44 
153805589  2 ETPAFFFTTFLGCLLLSITGYSIYVGFGPPSKQLRDPFEEHED 44 
194033297  2 ESPAFFFTLFLWFFLLSITIYSIYIGFGPPSKRLRDPFEEHED 44 
254798658  2 ESPAFFFSIFLWSLLLSITGYSIYVGFGPPSKQLKDPFEEHED 44 
304322995  2 ESPAFFFTIFLWFFLLSITAYSIYIGFGPPSKRLRDPFEEHED 44 
108796940  2 ESPAFFFSLFVWCLLLSITAYSLYVGFGPPSKQLRDPFEEHED 44 
115349997  2 DNPAFFFTIFLWFFLLSITAYSIYVGFGPPSKRLRDPFEEHED 44 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap