Conserved Protein Domain Family
atpF

?
CHL00019: atpF 
ATP synthase CF0 B subunit
Statistics
?
PSSM-Id: 176962
View PSSM: CHL00019
Aligned: 145 rows
Threshold Bit Score: 166.579
Threshold Setting Gi: 11465710
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153012207   1 MKNITDSFLCF-IYWPSA-GS--FGFDTDILATNLINLSVVLGVLIFFGKGVcasclfqrLSDLLDNRKQRILRTIRNSE 76 
41179054    1 MVFLPDNILIL-GH-----GG--FGFNTNVFETNIINLAAVVGIVVSFVGKN--------LSSLLEDRKNTIVKNLEEAN 64 
7524780     1 -MLLSTSFLLA--------GH--FGFNTNLLETNVLNLAVVLAIVLTYVGDA--------LRGLLANRKQSILTNFREAD 61 
108773033   1 ---MSFSFLFL-GNLPLA-EG--FGINTNIFETNIINLAAVVAIVISFVGKN--------LSALLEDRRKTIVNNLQEAS 65 
260780661   1 ---MSFSLLTIvNILPLGeGT--FGFNDNILETNVINLAVVVGIVVFFVGKN--------SSTFLENRQQTILNNLREAD 67 
108773332   1 METYMDTLNQL-STICFG-HGdgFGINTNILETNIINLSVVIGVVVSFGGDA--------LRSLLDNRKETILANLQEAD 70 
11466376    1 MTDILTNIFTIlSRMSLA-EG--FGFNTDIFETNILNLAVVLGILLTSGREF--------FVSLLQNRQQNILQSINDAD 69 
108796969   1 -----MNFIPI-SLIFSG-HG--FGFNTNIFETNVINLAVVIGVVVSFVGDA--------VRELLKNRKETIVNNLREAD 63 
194033268   1 -----MNLLTIfNILPLG-EG--FGFNDNILETNIINLAAVVGIVVFFVGKN--------FSILLENRQQTILNNLREAN 64 
115349968   1 ------------MSLPTG-EG--FGLNDNILETNVINLAVVVGVVVFFVGKN--------LTSILENRQETILNNLREAD 57 
153012207  77 ELREAAVEQLEKARARLRKVETEADRFRVNGYSEIEREKLNLINSIYTTLEQFENYKNETIHFEQQRAINQVQQTVLQQA 156
41179054   65 QRAIEAEQKLTAARTQLETAKKKAQEIREEGVLRATQEINNVVSQHELRLARLQEFKQETLAFYQQKAFKQAYLYVINKI 144
7524780    62 QRATEAQNKLREAQLELEQAQAKAQKIREQANVTIEQEKKQFIRQTQEDIKRLGTLQQETLKFEQQKAQNELAEKLVKLA 141
108773033  66 QRAAEAQERLNIAKNQLEVAKKKATEIREEGVFRATQEINNCVAQHEERLSKLEEFKQETVQFYQQKAFKQAYVYIISRI 145
260780661  68 QRAVEFLEKLNFAKSQLEYAEKKAQEIREEGELKATQEKNNCNTQHEEDLARLEEYKQETLQFYQQKAFTQYYVSIVSRA 147
108773332  71 LRAKEAQEKLAAARLQLEQAQTKAQEIRQQGTITAEQEKQLCIKQAEADMARLEDVKQQTLRLQQQRAMSQVSQQVIALA 150
11466376   70 ERYKEAAEKLQQAQNEFEQAKLEADQILAQSKKTASEIEVGLMNLIKEDTKKLLDMKQATISFEEEKAISEIRRQVIRLA 149
108796969  64 NRALEAQEKLSQAKAQLADAQKKATEIREQGLVAAEQEKKLCIKQAEEDAARLKQVQQDTIRFQQQKAIQQISQQIVSLA 143
194033268  65 QRASEALERYNQAKKQLELAEKKAKDIRQEGTLKARQEKENCFNQYKLDLVRLEEYKQETLQFYQQKAFQQIYVSIVSRA 144
115349968  58 QRASEAREKFNKAKEQLELAEQKAKQIRSEGLLKATTEKNNCLTQYEQDLARLDEYKQETLQFYQQKVFSQLYVSLVSKA 137
153012207 157 LQGALGTLNSCLNNELHLRTIGANIDMF-G--AMKDK-NN 192
41179054  145 MTRVRERLNKGLDSTYHVVVNNFYVSRF----------TQ 174
7524780   142 LQQVREKLNQRLTSSIHSAVNNFQIVLF-T--NSKAS--- 175
108773033 146 MSRVKERLNKGLDATYHVVVNNFYVSRF----TEYNP--- 178
260780661 148 LQRVKEKFNKPFDVVFHVTVNNFTIARFtEynPSNNFkER 187
108773332 151 LQKVRQKLQDAANSAFHTSVNNSNIAFF----TKYKV--- 183
11466376  150 LQRALEQSKSRLNRRLQKRVTRLNIGLL-G--RLVTP-ND 185
108796969 144 LQQVRQKLKMGASAPFHVSVNKSKIDLFkR--SL------ 175
194033268 145 LGEVKQKFNKPLSEQFHATINNFVIARL----TEYNP--- 177
115349968 138 LQKVKQKFDKRLDNQFHITVNNFFIARF----------TE 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap