Conserved Protein Domain Family
ndhH

?
CHL00017: ndhH 
NADH dehydrogenase subunit 7
Statistics
?
PSSM-Id: 176960
View PSSM: CHL00017
Aligned: 121 rows
Threshold Bit Score: 794.286
Threshold Setting Gi: 255961349
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
139390405   1 MNRPVTRKDLMIVNIGPHHPSMHGVLRLIVTLDGGDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEA 80 
11466758    1 -MMILTKNKPMIVSMGPHHPSMHGVLRLIVTLDGEDVLDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEA 79 
34501457    1 --MLATKTKPMIVSMGPHHPSMHGVLRLIVTLDGENVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEA 78 
28202230    1 MTMLAAKADPMTLSMGPHHPSMHGVLRLIVTLDGENVTDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEA 80 
18860375    1 MAMLLKNKDQMIVSMGPHHPSMHGVLRLIVTLDGENVADCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEA 80 
124302962   1 MTMLATKKDPMIVSMGPQHPSMHGVLRLIVTSDGENVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEA 80 
49574630    1 MSIRLEDIDPVVVSMGPHHPSMHGVLRLVVALQGENVVDCELILGYLHRGMEKIAENRTTSQYLPYVTRWDYLATMFTEA 80 
60117227    1 MTMLATEKNPMIVSMGPHHPSMHGVLRLIVTLDGENVTNCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEA 80 
223931104   1 --MLATKTKPMIVSMGPHHPSMHGVLRLMVSLDGENVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDYLATMFTEA 78 
242910155   1 MSMPLKEIDPVTVSMGPHHPSMHGVLRLIVTLDGENVVDCEPILGYLHRGMEKIAENRTILQYLPYVTRWDYLATMFTEA 80 
139390405  81 ITVNGPEQLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFREREFVYDLFEAATGMRMMHNFFRI 160
11466758   80 ITVNAPEKLTNIQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGAQTPFFYIFREREMIYDLFESATGMRMMHNYFRI 159
34501457   79 ITVNAPEKLTNIQVPKRASYIRMIMLELSRVASHLLWLGPFMADIGAQTPFFYILREREMIYDLFEAATGMRMMHNYFRI 158
28202230   81 ITVNAPEKLTNIQVPKRASYIRIIMLELSRIASHLLWLGPFMADIGAQTPFFYILREREMIYDLFEAATGMRMMHNFFRI 160
18860375   81 ITVNAPEKLANIRIPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYILREREMIYDLFEAATGMRMMHNYFRI 160
124302962  81 ITVNAPEKLANIQIPKRASYIRIIMLELSRIASHLLWLGPFMADVGAQTPFFYIFREREMIYDLFEAATGMRMMHNYFRI 160
49574630   81 VTVNAPEKLANIQIPERASYIRVIMLELSRIASHLLWLGPFLADIGAQTPFFYIFREREMIYDLFEAATGMRMMHNYFRI 160
60117227   81 ITVNAPEKLANIQVPKRASYIRVIMPELSRIASHLLWLGPFMADIGAQTPFFYIFRERETIYDLFEAATGMRMMHNYFRI 160
223931104  79 ITVNAPEKLTNIQVPKRASYIRIIMLELSRVASHLLWLGPFMADIGAQTPFFYILREREMIYDLFEAATGMRMMHNYFRI 158
242910155  81 VTVNAPEKLANIQVPGRASYIRVIMLELSRIASHLLWLGPFLADVGAQTPFFYIFREREMIYDLFEAATGMRMMHNYFRI 160
139390405 161 GGIAADLPYGWIDKCLDFCDYFLTEVVEYQKLITRNPIFLERVEGVGILGGEEAINWGLSGPMLRASGIQWDLRKVDRYE 240
11466758  160 GGVAVDLPYGWIDKCLDFCDYFLPKINEYERLITNNPIFLKRVEGIGTVTREEAINWGLSGPMLRASGVQWDLRKVDHYE 239
34501457  159 GGVAVDLPYGWIDKCLDFCDYFLPKVNEYERLITNNPIFLKRVEGIGIIGKEEAINWGLSGPMLRASGVQWDLRKVDHYE 238
28202230  161 GGVAVDLPYGWVDKCLDFCDYFSLKVDEYERLITYNSIFLKRVEGVGTISREEAINWGLSGLMLRASGVQWDLRKVDHYE 240
18860375  161 GGVAVDLPYGWIDKCLDFCDYFSPKISEYEKLIVHNPIFLERVKGVGFISREEAINWGLSGPMLRASGVQWDLRKVDHYE 240
124302962 161 GGVAVDFPYGWVDKCLDFCDYFLPKVDEYEQLITNNPIFLKRVEGVGFIGREEAINWGLSGPMLRASGVRWDLRKVDHYE 240
49574630  161 GGVAADLPYGWIDKCLDFCQYCLPKIYEYERLVTKNPIFLKRVQGVGFINRQEAINWGLSGPSLRASGVQWDLRKIDHYE 240
60117227  161 GGVAVDSPYGWVDKCSDFCNYSLPKVNEYERLITRNPIFLKRVEGVGTIGGEEAINWGLSGPMLRASGVQWDLRKVDHYE 240
223931104 159 GGVAVDLPYGWIDKCLDFCDYFLPKVDEYEKLITQNPIFLKRVEGIGIIEREEAINWGLSGPMLRASGVQWDLRKVDHYE 238
242910155 161 GGVAADLPYGWVDKCLDFCHYCLPKIHEYERLITKNPIFLRRVRGIGFISREEAINWGLSGPVLRASGVQWDLRKIDHYE 240
139390405 241 CYDEFEWEIQWQKQGDSLARYLVRLSEMTESIKIIQQALEGLPGGPYENLERRGF-D-RKmnsemnseMNSEWNNFDYRF 318
11466758  240 CYDELDWKIQWQKEGDSLARYLVRIGEMKESVKIIQQALKAIPGGPFENLEARRL-N-QG--------KNSEWNLFEYQF 309
34501457  239 CYDELDWQIQWQKEGDSLARYLVRIGEMKESIKIIQQALKSIPGGPYENLEARRL-Q-RG--------KKSEWNNFEYQF 308
28202230  241 CYDELDWQVQSQTEGDSLARYLVRIGEMRESVKIIQQALKVIPGGPYENLEARRL-N-QG--------KDSEWNDFEYQF 310
18860375  241 CYDEVDWQIQWQKEGDSLARYLVRIGEMRESVKILQQALRIIPGGPYENLEARRL-H-QS--------QNLEWNDFDYQF 310
124302962 241 CYDELDWQIQWQKEGDSLARYLVRIGEMRESVRIIQQALKVIPGGPYENLEARRL-N-QQ--------KDSEWNDFDYQF 310
49574630  241 CYDKLDWQIQWQGEGDSLARYLVRIDEMKESINILRQALKLLPGGPYENLEGRRLvQ-KK--------DKIDWNGFNYQF 311
60117227  241 CYDESDWQIQRQEEGDSLARYSVRIGETKESVKIVQQALKVIPGGPYENLEARRL-N-RG--------KNSEWNDFEYQF 310
223931104 239 CYDELDWQIQWQKEGDSLARYLVRIGEMKESIKIIQQALKSIPGGPYENLEARRF-Q-RE--------KKSEWNNFEYQF 308
242910155 241 CYDNLDWQIQWQTEGDSLARYLVRISEMKESIKIIKQALKLLPGGPYENLEGRRF-NqQQ--------GEVEWNDFNYQF 311
139390405 319 ISKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQSGFPWRWKIRPPGFINLQILPELVKRMKLADIMTILGSIDIIMGE 398
11466758  310 ISKKPSPTFKLPKQEHYVRVEAPKGELGIFLIGDDSVFPWRLKIRSPGFINLQILPQLVKGMKLADIMTILGSIDIIMGE 389
34501457  309 ISKKPSPTFKLPKQEHYIRVEAPKGELGVFLIGDDSVFPWRWKIRPPGFINLQILPQLVKGMKLADIMTILGSIDIIMGE 388
28202230  311 ISKKPSPTFKLPKQEHYIRVEAPKGELGIYLIGDDSVFPWRWKIRPPGFINLQILPQLVKGMKLADIMTILGSIDIIMGE 390
18860375  311 MGKKSSPTFKLLKQEHYVRIEAPKGELGIFLIGNDSVFPWRWKIRPPGFINLQILPQLVRGMKLADIMPILGSIDIIMGE 390
124302962 311 ISKKSSPTFKLPKQEHYVRIEAPKGELGIFLIGDDNVSPWRWKIRPPGFINLQILPQLVKGMKLADIMTILGSIDIIMGE 390
49574630  312 VGKKSSPTLKLPKQEHYVRVEAPKGELGIFLIGDDSVFPWRLKIRPPGFINLQIVPQLIRGMKLADIVTILGSIDIIMGE 391
60117227  311 ISRKPSPTFKLPKQEHYVRVEAPKGELGIFLMGDDSAFPWRWKIRPPGFINLQILPQLVEGVKLADIMTILGSIDITMGE 390
223931104 309 ISKKPSPTFKLPKQEHYIRVEAPKGELGVFLIGDDSVFPWRWKIRPPGFVNLQILPQLVKGMKLADIMTILGSIDIIMGE 388
242910155 312 VGKKSSPTLKSPKQEHYVRVEAPKGELGVFLIGDDSVFPWRWKIRPPGFTNLQILSQLIKGMKLADITTILGSIDIIMGE 391
139390405 399 VDR 401
11466758  390 VDR 392
34501457  389 VDR 391
28202230  391 VDC 393
18860375  391 IDR 393
124302962 391 VDR 393
49574630  392 VDR 394
60117227  391 VDR 393
223931104 389 VDR 391
242910155 392 VDR 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap