Conserved Protein Domain Family
ndhE

?
CHL00015: ndhE 
NADH dehydrogenase subunit 4L
Statistics
?
PSSM-Id: 176958
View PSSM: CHL00015
Aligned: 120 rows
Threshold Bit Score: 103.159
Threshold Setting Gi: 11467873
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329709   1 MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGDIFSIFVIAIAAAEAAIGSAI 80 
11466754    1 -MLEHILTLSAFLFCIGVFGLITSRNMVRALMCLELIFNAVNINLVAFSNFLDSSQIKGEIFSIFIIAIAAAEATIGLAI 79 
34501453    1 -MLEHILSLGAYLFCIGIFGLITSRNMVRALMCLELIFNAVNINLITFSNSFDTQQAKGEIFAIFIIAIAAAEAAIGLAI 79 
28202226    1 -MLEHALIAGAFSFCIGISGLITSRNMVRAPMCLESIFNAVNVNSVVSSNTLDAEEIKGEIFAIFVIAIAAAEAAIGLSI 79 
126022799   2 FALEHLLTLGAYLFCIGFYGLITSQNMIKALMCLELVLNAVNINFVTFSNYFDTQHIKGEIFVLFIMAIAAAEAAIGLAI 81 
255961345   1 MTLERAPISGAFPFRTGIYGSMTSRNMARAPMRPEPIPNAVNANPATSGHCAGARQMKGEISAISIMAIGSAEAAIGSAI 80 
108773228   1 MILQHILILSSFLFCLGIFGLITSQNMVKILICLELIFNAVNLNLVIFCKFFDSSAIIGNLFGLFIIAIAAAEAAIALAI 80 
22711914    1 -MIENILIIGAFLFCIGTYGLITSKNMIKVLMCLELMFNSVNINLVAFSNFFDSESIKGQVFAVFIIAIAAAEAAIGLAI 79 
60117231    1 -MFGHALLLGAFPFCIGIYGLITSRNTVRALMCLELIFNAVNVNFVTFPNYLDIQQIKGEILSVFVIAVAAAEAAIGSAI 79 
223931107   1 -MLEHVLNLGAYLFCIGIFGLITSRNMVRALMCLELVFNAVNINLITFSNSFDTQQSKGEIFAIFIIAIAAAEAAIGLAI 79 
114329709  81 VSSIYRNRKSTRINQSTLLNK 101
11466754   80 VLAIYRNRKSTRIDQFNLLKW 100
34501453   80 VLAIYRNKNSTRIDQFNLLKW 100
28202226   80 ALAIYRNRKSTRVD------- 93 
126022799  82 VLTIYRDRKSIRIDQFNLLK- 101
255961345  81 VPATYRSARPIRTDQSNSLKR 101
108773228  81 LLAMYRNRRSIRIDRFNILK- 100
22711914   80 VFALYRNRRSTKVNQFNLLKW 100
60117231   80 VLAIYRNRESIRIDQFNLLKW 100
223931107  80 VLAIYRNKNSTRIDQFNLLKW 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap