Conserved Protein Domain Family
ndhJ

?
CHL00012: ndhJ 
NADH dehydrogenase subunit J
Statistics
?
PSSM-Id: 176955
View PSSM: CHL00012
Aligned: 116 rows
Threshold Bit Score: 315.097
Threshold Setting Gi: 255961308
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157325533   1 MQSFLSVWLVKHGIIHRSLGFDYQGIETLQIKPEDWHSVAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVtr 80 
126022790   1 MQGRLSIWLIKHNLKHRPLGFDYQGIETLQIRSEDWPSLAVALYVYGFNYLRSQCAYDVEPGGLLASVYHFTKITDNA-- 78 
126021015   1 MQGRLSVWLANHKLPHRPLGFDYQGVEILQIRSEDWLSIAVALYVYGFNYLRSQCAYDVAPGGLLASVYHFTKIEDNV-- 78 
126022827   2 IQGRLSAWPIKHRLAHRPLGFDYQGVETLQVRSEDWLSIAVALYAYGSNYLRPQCVYDVALGGLLASVYHPTKVQSNA-- 79 
18860314    1 MQGRVSVWLSQHKLAHRPSGFDYQGIEIIQIKSEDWPSIAVALYIYGFNYLRSQCAYDVMPGGFLASVYHLTKLQDNA-- 78 
255961308  14 VQGQLPARPAEHESAHRPLGFDHQGIETPQIQSEDRPSIAVALYVYGSNHPRAQCARDVAPGGLLASVYHLAKVQDDE-- 91 
124302909   1 MQGRLSAWLAKHQLAHRPLGFDYQGIEILQIRPQDWPSIAVALYVYGFNYLRSQCAYDVTPGGGLASVYHLTKVQDDA-- 78 
90025052    2 TRGRLSAWLTKHNFSHRPLGYDYRGVEILEVKSEEWLSTAVALYAYGFNYLRSQCAYDATPGGSLVSVYHLTQMQDQS-- 79 
301353377  13 TRGRLSAWSTKHKFFHRPLGYDYRGVEILQVKSEEWLSVAVAPYAYGSNYSRSQCAYDATPGGFLVSVYHLTQMRDQS-- 90 
223931072  12 IQGRLSAWLAKHKLPHRPLGFDYQGVEILQIRSENWLSIAVALYVYGFNYLRSQCAYDVAPGGMLASVYHFTKIQDNA-- 89 
157325533  81 ieyGayQPEEVCIKVFASRKNSRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYVAPHFYE 160
126022790  79 ---D--QPEEICIKIFILRKNPKIPSIFWVWKSADFQERESYDMFGIFYENHPCLKRILMPDSWLGWPLRKDYIVPNFYE 153
126021015  79 ---D--QPEEICIKIFVSRQKPKIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPDTWIGWPLRKDYIVPDFYE 153
126022827  80 ---D--QPEEVCIKIFVSRKNPKIPFVFWVWKGADFQERESYDMLGISYESHPRLKRILMPDSWIGWPLRKDYIVPNFYE 154
18860314   79 ---D--QPEEVCIKILVSRESPKIPSIFWVWKSADFQERESYDMSGIHYESHPRLKRILMPESWIGWPLRKDYVVPNFYE 153
255961308  92 ---EadQPEELCIKVSVSKKHPRIPSVFRVRKSADLQERESYDMLGIFHESHPRLKRISMPDTWIGRPLRKDHTVPDFYE 168
124302909  79 ---D--QPEEVCIKIFVSREDPRIPSVFWIWKSSDFQERESYDMFGIIYESHPRLKRILMPESWIGWPLRKDYIVPNFYE 153
90025052   80 ---D--QPEEICVKVFVSRTNPQIPSVYWVWKSAEFQERESYDMLGIIYQGHPYLRRILMPESWIGWPLRKDYVVPNFYE 154
301353377  91 ---D--QPEEVCTKIFVPRKNPRIPSVYWVWKSSDLQERESYDMLGITHQDHPHLKRILMPESWIGWPLRKDYVVPNFYE 165
223931072  90 ---D--QPEEICIKIFVSRQNPKIPSVFWIWKSADFQERESYDMLGIYYENHPRLKRILMPDTWIGWPLRKDYIVPDFYE 164
157325533 161 IQDAH 165
126022790 154 LQDAY 158
126021015 154 LQDAY 158
126022827 155 LQDAY 159
18860314  154 LQDAY 158
255961308 169 PQDSL 173
124302909 154 LQDAY 158
90025052  155 LQDAY 159
301353377 166 LQDAY 170
223931072 165 LQDAY 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap