Conserved Protein Domain Family
ndhD

?
CHL00011: ndhD 
NADH dehydrogenase subunit 4
Statistics
?
PSSM-Id: 176954
View PSSM: CHL00011
Aligned: 117 rows
Threshold Bit Score: 782.208
Threshold Setting Gi: 255961343
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
127707434   1 MSNYPWLTIIVLLPIPAGLLIPLLpsPNGGNKIIRWYTLGICLLEFLLITHTFCYHFDIDNPFIQLREDYNWINIIDFHW 80 
11466752    1 MNHFPWLTIIVLFPISAGLVIPFL--PSTGNKIIRWYTLGVCLLEFLLITYIFCYHYQFNDHLIQLKEDYNWISFINFHW 78 
34501451    1 MSNFPWLTTIVLLPVFAGCVIPFF--PNKGNNLIRWYTLGVCLLEFLLITYVFCYYFKFDDPIIQLKEDYNWIDFLDFHW 78 
126022798   1 MSNLPWLTLIVLFPFSASFLIPLL--PYKGNKVVRWYTLGICALEFLLITFTFCCQFHLSDPSIQLKEDYNWISFLYFHW 78 
124302956   1 MSSLPWLTIIVLLPICAGLLIPLF--PNEGNKIIRWYTLGICIIEFLLITYIFCCHFRINDQSLQLEEDYNWIDLINFHW 78 
108773212   1 MNQFPWLSIIILFPLFAAFFIPLL--PSRENQTVRWYTLGICLLDFLVMSYIFGYYYDFHNSSFQFKESIEWIPTIGFKW 78 
90019558    1 MSNVPWLTVIVSLPIFAGLMIPIL--PRNGNRVTRWYTLGICILEFLLITYIFYCHFRIDYQSIQLLETFNWINNIHLHW 78 
301353350   2 MSNVPRLATIVLFPIFASLLLPIL--PRDGNRIIRWYTLGICILEFSSITYIFHSHFEIDFQSIQLLETSNWISSMHFHW 79 
223931109   1 MNNFPWLTTIVLLPISAGLVIPLF--PTKGNNIVRWYTLGICLLEFLLISYVFCYQFKFSNQLIQLNEDYNWINFLNFHW 78 
242910151   1 MSNVPRLTIIVLFPIFAGLLLPRL--PRNGNRIIRWYTPGIRILEFLLIIYIFHCHFRLDNQSIQLIENFNWINSINFHW 78 
127707434  81 RLGIDGFSIGLTPLTGFVTTLATLAAWPVTRSPRLFHSSMLAMYSGQVGLFTSQDILLFFLMWELELIPVYLLLSMWGGK 160
11466752   79 RLGIDGFSIGLILLTGFITTLATLAAWPVTRNPRLFYFLMLAMYSGQIGLFASQDILLFFFMWELELLPVYLLLAMWGGK 158
34501451   79 RLGIDGLSIGLILLTGFITTLATLAAWPVTRNPRLFYFLMLAMYSGQVGLFASQDILLFFFMWELELIPVYLLLCIWGGK 158
126022798  79 NLGVDGLSMGLILLTGFITTLAILAAWPVTRNVRLFYFLMLAMYSGQIGLFASQNILLFFFMWELELIPVYLLLSMWGGK 158
124302956  79 RLGIDGLSMGLILLTGFVTTLATLAAWPVTRNTRLFHFLMLAMYSGQIGLFASQDILLFFFMWELELIPIYLLLSIWGGK 158
108773212  79 ALGVDGLSMGLILLTGLVTTLAVLAAWPITCNPKLFYFLMLVMYSGQIGLFTSQDLFLFFLMWELELIPIYLLISLWGGR 158
90019558   79 SLGIDGLSLGLVILTGFATTLATLSAWPITRNTRLFYFLMLIMYGGQIGLFVSRDILLFFFMWEIELIPVYLLLCLWGGK 158
301353350  80 ILGIDGLSMGLILLTGFVTTPATSAAWPITRNTRLFHFSMLVMYSGQIGLFVSRDILLFFFMWELELIPVYLLLCLWGGK 159
223931109  79 RLGIDGLSIGLILLTGFITTLATLAAWPVTRNPRLFYFLMLAMYSGQIGLFASQDILLFFFMWELELIPVYLLLCIWGGK 158
242910151  79 RLGIDGLSMGLILLTGFVTTLATPAAWPITRNTRLFYFLMLVMYSGQIGLFASRDILLFFFMRELELIPIYLLLCLWGGK 158
127707434 161 RRLYAATKFILYTAGGSIPLLIGALTMGLHGFDEPTLDFQNLANRSYPIALEIVLYLSFFVAYAVKLPIFPLHTWLPDTH 240
11466752  159 RRLYAATKFILYTAAGSLFILIGGLIMAFYNSNEFTFDFQFLINKKYPLELEIIIYLSFLIAYAVKLPIIPFHTWLPDTH 238
34501451  159 RRLYATTKFILYTAGGSIFILMGALTMGFYGSNQLTLDFQNLSNKSYPLELEIILYLGFFIAYAVKLPIFPLHTWLPDTH 238
126022798 159 KRLYSSTKFLLYTAGGSIFLLVGSLTMGLYGSNGTSFDLQILTNRSYPIAVETALYFSFLIAYAVKLPILPFHTWLPDTH 238
124302956 159 RRLYSATKFILYTAGGSIFLLIGALTIGLYGNNGPLFDIQSLATRSYPIALEIIIYSGFLIAYAVKLPIFPFHTWLPDTH 238
108773212 159 RRLYAATKFIFYTAIGSLFLFIATFTVCFYGANIATWHFEDLAEKEYPFILEKILYLGFGFAYAVKLPIIPFHTWLPDTH 238
90019558  159 RRLYSATKFVLYTAGGSIFLLVAALTMSFYGSEVPSFNIQDLIHKSYPLSLEVLIYVGFLVAYAVKLPIFPFHTWLPDTH 238
301353350 160 RRSYSATKFVLYTAGGSIFLLVAALTTSFYGNDIPSFDIQDSMNRSYPISLEILLYLGFLIAYAVKLPIFPFHTWLPDTH 239
223931109 159 RRLYAGTKFILYTAGGSIFILMGALTMGFYGSNQLTLNLQNLCNKSYPIELEIILYLGFFIAYAVKLPIFPLHTWLPDTH 238
242910151 159 RRLYSATKFILYTAGGSIFLLVAALTMSFYGTEVPSFDIQDLTNKSYPISLEVLFYLGFLIAYAAKLPIVPFHTWLPDTH 238
127707434 241 GEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHSIFAPWLVIVGAFQIVYAASISSSQRNSKRRIAYSSISHMGFVLI 320
11466752  239 GEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSFFAPWLVIVGAIQIVYAALTSLSQRNLKRRIAYSSVSHMGFVLI 318
34501451  239 GEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHSIFAPWIVAVGAIQIVYAALISFSQRNLKRRIAYSSISHMGFVLI 318
126022798 239 GEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHFLFSPLLVTMGAVQIAYASLISFSLPNIKRRIAYSSVSHMGFVII 318
124302956 239 GEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHAIFAPWMVMFGAVQIVYASLISLNQRNLKRRIAYSSVSHMGFVMI 318
108773212 239 GEAHYSTCMLLAGILLKMGGYGWIRINMTLFPNAHAYFAPWLVILGTVQIIYAASVCLSQKNLKRRIAYSSISHMGFVLI 318
90019558  239 GEAHYSTCMLLAGVLLKMGGYGLIRINLELLTHAHFLLGSWMMLFGAIQIIYASLISMSQRNFKRRIAYSSISHMGFVTI 318
301353350 240 GEAHYSTCMLLAGVLSKMGGYGLIRINLELLTHAHFLFGSWLMLFGAIQIVYASLASMSQRNLKRRIAYSSISHMGFVAI 319
223931109 239 GEAHYSTCMLLAGILLKMGGYGIIRINMELLPHAHLIFAPWIVLIGAIQIVYAAFTSFSQRNLKRRIAYSSISHMGFVLI 318
242910151 239 GEAHYSTCMLLAGVLLKMGGYGLIRINLELLTHAHSIFGSWLVLFGAIQIVYASMISLSQRNLKRRIAYSSISHMGFVTI 318
127707434 321 GIGSATNIGLNGAILQMISHGLIGAAPFSLAGTSYDRTRTPFLDQMGGIGTSMPKTFTMFSSFSMASLALPGTSGFAAES 400
11466752  319 GIGSITNLGLNGAILQMISHGLIGASLFFLAGISYDRTRTLVLDQMGGIGNSMPKIFTLFTSCSMASLALPGMSGFIAEL 398
34501451  319 GIGSMTDVGLNGAILQMVSHGLIGAALFFLAGITYDRTRTLFLDQMGGTAIYMPKIFTMFSSFSMASLALPGMSGFVAEF 398
126022798 319 GISSITDIGTNGAILQMISHGLIGAALFFLAGISYDRTQTLYLDQLGGIAVPMPRLFTMFSFFSLASLALPGMSSFVAEF 398
124302956 319 GIGSLTNIGLNGAILQMISHGLTGAALFFLAGTSYDRTRTLFLDQLGGIAISMPKLFTMFSIFSLASLALPGMSGFVAEL 398
108773212 319 GICSFTNIGLSGAICQMISHGLIGASLFFLAGTTYDRIRTVSLSEMGGIALKMPKMFSMFTGFSLASLALPTMSGFVAEM 398
90019558  319 GIGSFTETGINGAILQMISHGLIGAALFFLAGTCYDRTRTYLLDQLGGAAISMPKLFTMFSTLSLASLALPGMSGFVSEL 398
301353350 320 GIGSLTDAGINGAISQMISHGLIGAALFFLAGTCYDRTRTLFLDQLGGIATPMPKLFTMFTVFSLASLALPGMSGFVSEL 399
223931109 319 GIGSMTNLGLNGAILQMISHGLIGAALFFLAGISYDRTRTLFLDQMGGTAIYMPKIFTMFSSFSMASLALPGMSGFVAEF 398
242910151 319 GIGSSTNTGINGAILQMISHGLIGAAPFFLAGTCYDRTRTLSLDQLGGIAIPMPRLFTMFSIFSLASLALPGMSGFASEL 398
127707434 401 MVFPGIVSGKNYSLPFKIIITIVEAIGIILTPIYLLSMLRQMFYGYfnKV--SNLSISHAMDSGPREIFISICLLLPTIG 478
11466752  399 MIFLGVIDNPNYSSLFKIIIIIIQGIGIILTPIYLLSMLRQMFYGY--KF--SNTLEPYFMDAGPREIFILICLFFPIIS 474
34501451  399 LVFLGIVVSNKYSFNFKILVTIIEAIGIILTPIYLLSMLRQMFYGY--KFskFTTFSNSNMDAGPREIFILVCLIFPIVG 476
126022798 399 LIFLGIVTNPYYSLIFKSIILFIGAIGVILTPIYLLSMLRKMFYGF--KI--YQNSLF-FIDLGPREIFISVFILLPILG 473
124302956 399 MVFLGIVISQNYSLTFKIVITIIEAIGIILTPIYLLSMLRQMFYGY--KI--PNTLALSLIDSGPREIFISLCLLLPIIG 474
108773212 399 MIFLGIISSTFYSPSFRCFIILFQALGVILTPIYLLSMLRQMFYGV--DT--FHFESMSFIDSGPREVFIIVSLFIPVII 474
90019558  399 LVFLGVVTSNQYSFAFKAGITVLEGIGTVLTPIYLLSMLRQLFYGY--RF--FDKSNPYSIDLGPRELFILICFLLPILG 474
301353350 400 LVFSGVITSERYSFLFKTGITALEATGTVLTSIYLLSMLRRIFYGY--RL--VNESNPYLIDFGPRELFISTCLLLPILG 475
223931109 399 LIFLGIVISHKYSFNFKIVITIIEAIGIILTPIYLLSMLRQVFYGY--KF--SKFLVFSDMDAGPREIFILICLIFPIIG 474
242910151 399 LVFPGVVTNKQYSSLFKVAITIVEATGTALTPIYSLSMLRRIFYGY--RL--SNESNPYLIDSGPRELFILICLFLPILG 474
127707434 479 IGLYPNLILSLCNSKVEFI-LSHNF 502
11466752  475 IGIYPNFVLSIWNSKVNFL-LSNNF 498
34501451  477 IGLYPNSVLSLWNSKVSFI-LSKFI 500
126022798 474 IGIYPNLVLSLWNEKVESI-LLQYY 497
124302956 475 IGLYPNLVLSLWNSEVEYI-LSQY- 497
108773212 475 IGLYPNILLSIWQNALSIL------ 493
90019558  475 IGLYPNLILSIGSTEIPSLpLT--- 496
301353350 476 IGSYPNLILPLRGSKVLPI-LSSYS 499
223931109 475 IGIYPNSVLSLWNSKVNFI-LSKFI 498
242910151 475 IGLYPNMVLHLWNSKVLSI-LFSYS 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap