Conserved Protein Domain Family
petG

?
CHL00008: petG 
cytochrome b6/f complex subunit V
Statistics
?
PSSM-Id: 176951
View PSSM: CHL00008
Aligned: 132 rows
Threshold Bit Score: 53.5585
Threshold Setting Gi: 90994509
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329675  1 MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL 37 
189095320  1 MIEPLLFGIVLGMIPVTLTGLFVAAYLQYKRGNQLGL 37 
71842301   1 MVEVLLSGIVLGLVPVTITGLFVAAYLQYRRGNQFGL 37 
215400808  1 MIEPLLFGIVLGIVPVTIIGLFIAAYLQYRRGNQIGL 37 
11467710   1 MIEPLLFGIVLGLIPVTLTGLFVAAYLQYRRGNQFGL 37 
118411145  1 MVEPLLSGIVLGMITVSAFGLFVAAFLQYRRGNQFEI 37 
242620085  1 MVEPLLFGIVMGMMAVSLLGLFVAAYLQYRRGQDTES 37 
242624312  1 MVEPLLFGIVLGMMSVSLLGLFVAAYLQYRRGQDSES 37 
299830319  1 MVEPLLSGIVLGMITVSALGLFVAAFLQYRRGNQFEV 37 
299830525  1 MVEPLLSGIVLGMITVSALGLFVAAFLQYRRGNQFEV 37 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap