Conserved Protein Domain Family
rps16

?
CHL00005: rps16 
ribosomal protein S16
Statistics
?
PSSM-Id: 176950
View PSSM: CHL00005
Aligned: 74 rows
Threshold Bit Score: 103.181
Threshold Setting Gi: 50233950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465818   1 MVKLRLKRYGRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPITNETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAKE 80 
90994543   1 MVKLRLKRYGRKKQPSYRIVVMDSRNKRDGKAIEELGFYNPINNETRVNISKILQRLSQGAQATKTVKNILNKAQIVAEK 80 
11467477   1 MLKLRLKRSGRKKQPSYRLVVMENTTRRDGRPVEQVGYYNTITKESYFDVIKIKKWLNYGAKPTQTVLNLLKKAKIIDQ- 79 
118411051  1 MLKLRLKRTGRKRSPSYRLVVMENTARRDGRPIEELGYYSPITKQYKFDVEKIKKWLDFGVKPTETVSSLLRKAEIIS-- 78 
118411184  1 MLKLRLKRNGRKRQPAYRLVIMESTTRRNGRPVDEVGYYNPITKESYFNKEKIVKWLSYGVQPTETVFQLLKKSNLIEI- 79 
149072102  1 MLKLRLKKYGRKRQASYRIVVMPSTTKRDGRSIEELGFYNPHTNETNLNVSRIQARLNEGAQPTPTVRDLLKKAAVLS-- 78 
242620035  1 MLKLRLKRGGRKGQPAYRVVIMESNSRRDGRPIEDLGYYNPISKKFLVSFDRISVRLKQGVQPTQAVKNLLKRAGIAGV- 79 
242624260  1 MLKLRLKRGGRKRQPAYRVVLIQSDARREGRPVESLGYYKPISKEFVVNSERIKIRLEQGAKPTDTVRNLLIKSGIMESH 80 
299830417  1 MLKLRLKRIGRKRSPSYRLVIMENTTRRDGRPIEEVGYYNPISKNYKFDSEKIQKWLSYGVQPTETVANLLKKAEII--- 77 
299830592  1 MLKLRLKRIGRKRSPSYRLVIMENATRRDGRPIEEVGYYDPISKKYKFDSEKIQKWLKDGVQPTQTVLNLLKKADII--- 77 
11465818  81 NS 82 
90994543  81 NN 82 
11467477     --    
118411051    --    
118411184    --    
149072102    --    
242620035    --    
242624260 81 VK 82 
299830417    --    
299830592    --    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap