Conserved Protein Domain Family
psbD

?
CHL00004: psbD 
photosystem II protein D2
Statistics
?
PSSM-Id: 176949
View PSSM: CHL00004
Aligned: 167 rows
Threshold Bit Score: 656.924
Threshold Setting Gi: 255961353
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114329651   1 MTIALGKFTKeEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVS 80 
11467794    1 MTIAIGTPEE-KRGLFDDMDDWLRRDRFVFVGWSGLLLLPCAYFAVGGWLTGTTFVTSWYTHGLASSYLEGCNVLTAAVS 79 
108773343   1 MTIAIGKSEQ-KRGWFDLLDDWLRRDRFVFVGWSGLLLLPCAYFALGGFLTGITFVSSWYTHGLASSFLEGCNFLTAAVS 79 
108796979   1 MTIAIGKSEQ-KRGLFDVADDWLRRDRFVFVGWSGLLLLPCAYFALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVS 79 
115443541   1 MTIAIGKAEE-ERGVFDIIDDWLRRDRFVFIGWSGLLLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVS 79 
224179427   1 MTIAIGKVEE-KRSAFDVLDDWLRRDRFVFVGWSGLLLLPCAYFAVGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVS 79 
224178063   1 MTIAIGKTEE-KRGWFDDVDDWLKRDRFVFVGWSGLLLFPCAFLALGGWLTGITFVTSWYTHGLASSFLEGCNVLTAAVS 79 
224179469   1 MTIAIGKSEE-KRGWFDDADDWLKRDRFVFVGWSGILLLPCAYFALGGWFTGTTYVTSWYTHGLASSYLEGCNVLTAAVS 79 
226968644   1 MTIALGKVEE-KRGWFDNVDDWLKRDRFVFVGWSGILLFPCAYFAVGGWFTGTTFVTSWYTHGLASSYLEGCNFLTSAVS 79 
113170413   1 MTIALGKVDE-KRGWFDNVDDWLKRDRFVFVGWSGILLFPCAYFALGGWLTGTTFVSSWYTHGLASSYLEGCNFLTSAVS 79 
114329651  81 TPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLI 160
11467794   80 TPANSMAHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGSFGLIGFMLRQFEIARAIGLRPYNAIAFSGPISVFVSVFLI 159
108773343  80 TPPNSMGHSLLFLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFEIARSVKIRPYNAIAFSAPIAVFVSVFLI 159
108796979  80 TPPNCMGHSLLLLWGPEAQSDFTRWCQLGGLWTFVALHGSFGLIGFMLRQFEIARAVKIRPYNAIAFSGPIAVFVSVFLI 159
115443541  80 TPSNAVGHSLLFLWGLEAQGNFTRWCQLGGLWPFVALHGSFALIGFMLRQFEIAQSVRLRPYNAIAFSGPISVFVSVFLI 159
224179427  80 TPANSMAHSLLLLWGPEAQGNFTRWCQLGGLWTFVALHGAFGLIGFMLRQFEIARAVQLRPYNAIAFSAPIAVFVSVFLI 159
224178063  80 TPSNSMAHSLLLLWGPEAQGELTRWFQLGGLWTFVALHGAFGLIGFMLRQFEIARAVQIRPYNAIAFSGPISVFVSVFLI 159
224179469  80 TPANSMAHSLLFLWGPEAGGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFEIARAVQLRPYNAIAFSAPIAVFVSVFLI 159
226968644  80 TPSNSMAHSLLLLWGPEAQGEFTRWCQLGGLWTFVALHGAFGLIGFMLRQFEIARAVQIRPYNAIAFSAPIAVFVSVFLI 159
113170413  80 TPSNSMAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFEIARAVQIRPYNAIAFSAPIAVFVSVFLI 159
114329651 161 YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 240
11467794  160 YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
108773343 160 YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
108796979 160 YPLGQAGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGILGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
115443541 160 YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
224179427 160 YPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
224178063 160 YPLGQSGWFFAPSFGVAGIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
224179469 160 YPLGQSGWFFAPSFGVAGIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ 239
226968644 160 YPLGQSGWFFAPSFGVAGIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGSNTFRAFNPTQ 239
113170413 160 YPLGQSGWFFAPSFGVAGIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGSNTFRAFNPTQ 239
114329651 241 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 320
11467794  240 AEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQELRAAEDPEFETFYTKNL 319
108773343 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
108796979 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNN 319
115443541 240 QEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
224179427 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
224178063 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
224179469 240 SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
226968644 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
113170413 240 AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNI 319
114329651 321 LLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL 353
11467794  320 LLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL 352
108773343 320 LLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL 352
108796979 320 LLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL 352
115443541 320 LLNEGIRAWMVAQDQPHEKIVFPEEVLPRGNAL 352
224179427 320 LLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL 352
224178063 320 LLNEGIRAWMAAQDQPHEQLVFPEEVLPRGNAL 352
224179469 320 LLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL 352
226968644 320 LLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL 352
113170413 320 LLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap