Conserved Protein Domain Family
psbA

?
CHL00003: psbA 
photosystem II protein D1
Statistics
?
PSSM-Id: 176948
View PSSM: CHL00003
Aligned: 186 rows
Threshold Bit Score: 504.419
Threshold Setting Gi: 301500844
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
301500844   1 M-KTKRFTWMReisrtVFNFVQNTDRRLYIGWFGLLMVPTLLLAVSCFIAAFVAAPPVDIDGIREPVSGSLLYGNNIISG 79 
118411049   7 R-RQSVSLWER-----FCGWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIITG 80 
269100997   7 R-REEKRDWGT-----FATWITSTENRLYIGWFGCLMIPTLLTAASCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
269101059   7 R-REEKRDWGT-----FATWITSTENRLYIGWFGCLMIPTLLTAASCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
118411226   7 R-REGVSLWER-----FCAWITSTENRLYIGWFGCLMFPTLLTATSCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
299830420   7 R-RESVSVWER-----FSAWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
299830589   7 R-RESVSVWER-----FSAWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
301500921   1 M-KTKRFTWMReisrtVFNFVQNTDRRLYIGWFGLLMVPTLLLAVSCFIAAFVAAPPVDIDGIREPVSGSLLYGNNIISG 79 
301500987  13 KlSGASMLWNR-----FAAWVTSTENRLYIGWFGVVMIPCLLTATTCFIVAFIAAPPVDIDGIREPVAGSLLYGNNIISG 87 
118411180   7 R-REGVSLWER-----FCAWITSTENRLYIGWFGCLMFPTLLTATSCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80 
301500844  80 AVVPSSNAIGMHLYTVWDAMCIEEWLYNGGPYQFVVLHFLIGVASYLGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 159
118411049  81 AVIPSSNAIGIHFYPIWEAASVDEWLYNGGPYQLIVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
269100997  81 AVIPSSNAIGIHFYPIWEAASVEEWLYNGGPYQLIVFHFLIGVACWMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
269101059  81 AVIPSSNAIGIHFYPIWEAASVEEWLYNGGPYQLIVFHFLIGVACWMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
118411226  81 AVIPSSNAIGMHFYPIWEAASVDEWLYNGGPYQLIVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
299830420  81 AVIPSSNAIGMHFYPIWEAASIDEWLYNGGPYQLIVLHFLTGVAAYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
299830589  81 AVIPSSNAIGMHFYPIWEAASIDEWLYNGGPYQLIVLHFLLGVAAYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
301500921  80 AVVPSSNAIGMHLYTVWDAMCIEEWLYNGGPYQFVVLHFLIGVASYLGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 159
301500987  88 AVIPSSNAIGVHLYPIWEAASIEEWLYNGGPYQLVVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 167
118411180  81 AVIPSSNAIGMHFYPIWEAASVDEWLYNGGPYQLIVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV 160
301500844 160 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSTLISMTSEDESPNYGYKFG 239
118411049 161 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG 240
269100997 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEVESVNYGYKFG 240
269101059 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEVESVNYGYKFG 240
118411226 161 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG 240
299830420 161 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG 240
299830589 161 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG 240
301500921 160 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSTLISMTSEDESPNYGYKFG 239
301500987 168 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTEEESTNYGYRLG 247
118411180 161 YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG 240
301500844 240 QEYETYNIVAAHGYFGRLIFQFASFNNSRSLHFFLAIWPVVGIWLTAMGISTMAFNLNGFNFNQSIIDAEGRVISSWADI 319
118411049 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVVGIWLTAMGVSTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
269100997 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTALGVSTMAFNLNGFNFNQSVVDSEGRVINTWADI 320
269101059 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTALGVSTMAFNLNGFNFNQSVVDSEGRVINTWADI 320
118411226 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVLGIWLTAMGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
299830420 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVLGIWLTAMGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
299830589 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVVGIWLTAMGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
301500921 240 QEYETYNIVAAHGYFGRLIFQFASFNNSRSLHFFLAIWPVVGIWLTAMGISTMAFNLNGFNFNQSIIDAEGRVISSWADI 319
301500987 248 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAVWPVVGIWLTAMGISTMAFNLNGFNFNQSVVDSEGRVINTWADV 327
118411180 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVLGIWLTAMGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
301500844 320 LNRANLGMEVMHERNAHNFPLDLA 343
118411049 321 INRADLGMEVMHERNAHNFPLDLA 344
269100997 321 INRADLGMEVMHERNAHNFPLDLA 344
269101059 321 INRADLGMEVMHERNAHNFPLDLA 344
118411226 321 INRADLGMEVMHERNAHNFPLDLA 344
299830420 321 INRADLGMEVMHERNAHNFPLDLA 344
299830589 321 INRADLGMEVMHERNAHNFPLDLA 344
301500921 320 LNRANLGMEVMHERNAHNFPLDLA 343
301500987 328 LNRADLGMEVMHERNAHNFPLDLA 351
118411180 321 INRADLGMEVMHERNAHNFPLDLA 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap