NCBI logo
BLAST module of the MLA course on Introduction to Molecular Biology Information Resources
Course Home Modules Schedule Exercises Comments Credits
Slide 1 Previous Next Slide List

User Question:
Normal vs. Disease Gene

 
How does the sequence obtained from patients with sleep disturbances differ from the normal sequence?


Patient sequence:   RTGVGTHLTSLALPGKAEGVASLTSQCSYSSTIVHVGDKKP
Normal sequence:  RTGVGTHLTSLALPGKAESVASLTSQCSYSSTIVHVGDKKP

   
 
    Answer

BLAST
Slide 1 Previous Next Slide List
Revised 11/05/2007