BLAST: User Question and Answer
Course Home Modules Schedule Exercises Comments Credits
Problem Summary:

Compare a gene sequence from normal versus diseased patients

  Sample User Question
Analysis/Comments
Flow Chart
Additional Notes
 

Sample User Question back to top

 
How does the sequence obtained from patients with sleep disturbances differ from the normal sequence?


Patient sequence:   RTGVGTHLTSLALPGKAEGVASLTSQCSYSSTIVHVGDKKP
Normal sequence:  RTGVGTHLTSLALPGKAESVASLTSQCSYSSTIVHVGDKKP

   
 

Analysis/Comments back to top

By determining which amino acids are different in normal versus diseased patients, the researchers can contribute to the understanding of circadian biology. The BLAST 2 Sequences Program (Pairwise BLAST) permits a comparison of two sequences to each other (not to the database).

Flow Chart back to top

  1. BLAST 2 Sequences, Sequence 1 - Enter patient sequence into first query box.

  2. BLAST 2 Sequences, Sequence 2 - Enter normal sequence into second query box.

  3. Choose blastp (Program) - Use pulldown menu to choose protein blast (blastp) because amino acids are being compared.

  4. Click Align

Additional Notes back to top

The results page shows a difference in one amino acid between the two sequences.


BLAST User Question Return to Slides Revised 11/05/2007
Return to Circadian Rhythms Umbrella Page