NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17719.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17719.1 Public Mus musculus 3 Chil4 21 106 86 CCDS HistoryNCBI Gene:104183Re-query CCDS DB by CCDS ID:17719.1Re-query CCDS DB by GeneID:104183See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17719.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000082219 ENSMUSP00000080851 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000082219Link to Ensembl Protein Viewer:ENSMUSP00000080851Re-query CCDS DB by Nucleotide ID:ENSMUST00000082219Re-query CCDS DB by Protein ID:ENSMUSP00000080851
Original member Current member EBI,WTSI OTTMUST00000040348 OTTMUSP00000018028 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040348Link to Vega Protein Viewer:OTTMUSP00000018028Re-query CCDS DB by Nucleotide ID:OTTMUST00000040348Re-query CCDS DB by Protein ID:OTTMUSP00000018028
Original member Current member NCBI NM_145126.2 NP_660108.2 Accepted alive Link to Nucleotide Sequence:NM_145126.2Link to Protein Sequence:NP_660108.2Re-query CCDS DB by Nucleotide ID:NM_145126Re-query CCDS DB by Protein ID:NP_660108Link to BLink:NP_660108.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660108.2 402 Q91Z98 402 100% 0 0

Chromosomal Locations for CCDS 17719.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 106201777 106201808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106202519 106202660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106202742 106202861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106203662 106203847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106204068 106204191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106205995 106206119 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106210473 106210638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106211285 106211341 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106214275 106214476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106214990 106215019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 106219440 106219464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1209 nt):
ATGGCCAAGCTCATTCTTGTCACAGGTCTGGCAATTCTTCTGAATGTACAGCTGGGATCTTCCTACCAGC
TG
ATGTGCTACTATACCAGCTGGGCTAAGGACAGGCCAACAGAAGGGAGTTTCAAACCTGGTAATATTGA
C
CCCTGCCTGTGTACTCACCTGATCTATGCCTTTGCTGGGATGAAGAATAATGAGATCACTTACTTAAGT
GAG
CAAGACTTGCGTGACTATGAAGCATTAAATGGTCTGAAAGACAGGAACACTGAGCTAAAAACTCTCC
TG
GCCATTGGAGGATGGAAGTTTGGACCTGCCCCGTTCAGTTCCATGGTCTCTACTCCTCAGAACCGTCA
G
ACATTCATTAAGTCAGTTATCAGATTCCTTCGTCAATATAACTTTGATGGCCTCAACCTGGACTGGCAG
TAC
CCTGGGTCTCGAGGAAGCCCTCCTAAGGACAAACATCTCTTCAGTGTTCTGGTGCAGGAAATGCGTA
AA
GCTTTTGAGGAAGAATCCACTTTGAACCACATTCCAAGGCTGCTACTCACTTCCACAGGAGCTGGATT
C
ATTGACGTAATCAAGTCTGGGTACAAGATCCCTGAACTGTCTCAGTCTCTCGACTATATTCAGGTCATG
ACA
TATGATCTCCATGATCCTAAGAATGGCTACACTGGAGAAAATAGTCCCCTCTATAAATCTCCATATG
AC
ATTGGAAAGAGTGCTGATCTCAATGTGGATTCAATTATTACCTACTGGAAGGACCATGGAGCAGCTTC
T
GAGAAGCTCATTGTGGGATTTCCAGCATATGGTCATACCTTTATCCTGAGTGACCCTTCTAAGAATGGA
ATA
GGTGACCCTACTGTTAGTGCTGGACCACCAGGAAAGTACACAAATGAACAAGGACTCCTGGCTTACT
TT
GAGATTTGTACATTTCTGAATGAAGGAGCCACTGAGATCTTTGATGCCACCCAGGAAGTACCCTATGC
C
TATCTGGGTAATGAGTGGGTTGGTTATGACAATGTCAGGAGCTTCAAGTTGAAGGCTCAGTGGCTCAAG
GAC
AACAATTTAGGAGGTGCCGTGGTCTGGCCCCTGGACATGGATGACTTCAGTGGTTCTTTCTGTCACC
AG
GGACGTTTCCCTCTGACAACTACTTTAAAGAGAGATCTGAATGTACACAGTGCAAGTTGCAAGGCCTC
T
TATCGAGGGGAGCTTTAG


Translation (402 aa):
MAKLILVTGLAILLNVQLGSSYQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLS
E
QDLRDYEALNGLKD
RNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQ
Y
PGSRGSPPKDKHLFSVLVQ
EMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVM
T
YDLHDPKNGYTGENSPLYKSPYDIGKSADLNV
DSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNG
I
GDPTVSAGPPGKYTNEQGLLAYFE
ICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLK
D
NNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSA
SCKASYRGEL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser