NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28652.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28652.1 Public Mus musculus 17 Ppt2 21 106 86 CCDS HistoryNCBI Gene:54397Re-query CCDS DB by CCDS ID:28652.1Re-query CCDS DB by GeneID:54397See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28652.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000064953 ENSMUSP00000068071 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064953Link to Ensembl Protein Viewer:ENSMUSP00000068071Re-query CCDS DB by Nucleotide ID:ENSMUST00000064953Re-query CCDS DB by Protein ID:ENSMUSP00000068071
Original member Current member EBI,WTSI ENSMUST00000169067 ENSMUSP00000127372 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169067Link to Ensembl Protein Viewer:ENSMUSP00000127372Re-query CCDS DB by Nucleotide ID:ENSMUST00000169067Re-query CCDS DB by Protein ID:ENSMUSP00000127372
Original member Current member EBI,WTSI ENSMUST00000171121 ENSMUSP00000127745 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171121Link to Ensembl Protein Viewer:ENSMUSP00000127745Re-query CCDS DB by Nucleotide ID:ENSMUST00000171121Re-query CCDS DB by Protein ID:ENSMUSP00000127745
Original member Current member EBI,WTSI ENSMUST00000171376 ENSMUSP00000131243 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171376Link to Ensembl Protein Viewer:ENSMUSP00000131243Re-query CCDS DB by Nucleotide ID:ENSMUST00000171376Re-query CCDS DB by Protein ID:ENSMUSP00000131243
Original member Current member EBI,WTSI ENSMUST00000166040 ENSMUSP00000132006 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166040Link to Ensembl Protein Viewer:ENSMUSP00000132006Re-query CCDS DB by Nucleotide ID:ENSMUST00000166040Re-query CCDS DB by Protein ID:ENSMUSP00000132006
Original member Current member EBI,WTSI ENSMUST00000168391 ENSMUSP00000132339 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168391Link to Ensembl Protein Viewer:ENSMUSP00000132339Re-query CCDS DB by Nucleotide ID:ENSMUST00000168391Re-query CCDS DB by Protein ID:ENSMUSP00000132339
Original member Current member EBI,WTSI OTTMUST00000091876 OTTMUSP00000050660 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091876Link to Vega Protein Viewer:OTTMUSP00000050660Re-query CCDS DB by Nucleotide ID:OTTMUST00000091876Re-query CCDS DB by Protein ID:OTTMUSP00000050660
Original member Current member EBI,WTSI OTTMUST00000091877 OTTMUSP00000050661 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091877Link to Vega Protein Viewer:OTTMUSP00000050661Re-query CCDS DB by Nucleotide ID:OTTMUST00000091877Re-query CCDS DB by Protein ID:OTTMUSP00000050661
Original member Current member EBI,WTSI OTTMUST00000091878 OTTMUSP00000050662 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091878Link to Vega Protein Viewer:OTTMUSP00000050662Re-query CCDS DB by Nucleotide ID:OTTMUST00000091878Re-query CCDS DB by Protein ID:OTTMUSP00000050662
Original member Current member EBI,WTSI OTTMUST00000091879 OTTMUSP00000050663 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091879Link to Vega Protein Viewer:OTTMUSP00000050663Re-query CCDS DB by Nucleotide ID:OTTMUST00000091879Re-query CCDS DB by Protein ID:OTTMUSP00000050663
Original member Current member EBI,WTSI OTTMUST00000091880 OTTMUSP00000050664 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091880Link to Vega Protein Viewer:OTTMUSP00000050664Re-query CCDS DB by Nucleotide ID:OTTMUST00000091880Re-query CCDS DB by Protein ID:OTTMUSP00000050664
Original member Current member EBI,WTSI OTTMUST00000091909 OTTMUSP00000050681 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091909Link to Vega Protein Viewer:OTTMUSP00000050681Re-query CCDS DB by Nucleotide ID:OTTMUST00000091909Re-query CCDS DB by Protein ID:OTTMUSP00000050681
Original member Current member NCBI NM_001302393.1 NP_001289322.1 Accepted alive Link to Nucleotide Sequence:NM_001302393.1Link to Protein Sequence:NP_001289322.1Re-query CCDS DB by Nucleotide ID:NM_001302393Re-query CCDS DB by Protein ID:NP_001289322Link to BLink:NP_001289322.1
Original member Current member NCBI NM_001302394.1 NP_001289323.1 Accepted alive Link to Nucleotide Sequence:NM_001302394.1Link to Protein Sequence:NP_001289323.1Re-query CCDS DB by Nucleotide ID:NM_001302394Re-query CCDS DB by Protein ID:NP_001289323Link to BLink:NP_001289323.1
Original member Current member NCBI NM_001302395.1 NP_001289324.1 Accepted alive Link to Nucleotide Sequence:NM_001302395.1Link to Protein Sequence:NP_001289324.1Re-query CCDS DB by Nucleotide ID:NM_001302395Re-query CCDS DB by Protein ID:NP_001289324Link to BLink:NP_001289324.1
Original member Current member NCBI NM_001302396.1 NP_001289325.1 Accepted alive Link to Nucleotide Sequence:NM_001302396.1Link to Protein Sequence:NP_001289325.1Re-query CCDS DB by Nucleotide ID:NM_001302396Re-query CCDS DB by Protein ID:NP_001289325Link to BLink:NP_001289325.1
Original member Current member NCBI NM_019441.5 NP_062314.1 Accepted alive Link to Nucleotide Sequence:NM_019441.5Link to Protein Sequence:NP_062314.1Re-query CCDS DB by Nucleotide ID:NM_019441Re-query CCDS DB by Protein ID:NP_062314Link to BLink:NP_062314.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001289322.1 302 O35448 302 100% 0 0
NP_001289323.1 302 O35448 302 100% 0 0
NP_001289324.1 302 O35448 302 100% 0 0
NP_001289325.1 302 O35448 302 100% 0 0
NP_062314.1 302 O35448 302 100% 0 0

Chromosomal Locations for CCDS 28652.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 34617344 34617487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34617664 34617718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34622851 34622935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34623031 34623114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34625637 34625744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34625836 34625931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34626459 34626612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 34626805 34626987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (909 nt):
ATGCCGGGGCTATGGAGGCAGAGGCTTCCTTCGGCTTGGGCTTTGCTTCTCCTGCCGTTCCTGCCGCTGC
TG
ATGCCCGCAGCCCCCGCAGCCCACCGCGGGTCCTACAAGCCCGTGATCGTGGTGCACGGGCTCTTTGA
C
AGTTCATACAGCTTCCGCCACCTGCTGGACTATATCAATGAGACACACACCGGGACTGTGGTGACAGTG
CTT
GATCTCTTCGATGGCAGAGAGAGTTTGCGGCCCCTGTGGGAACAGGTACAAGGGTTCCGAGAGGCTG
TG
GTCCCCATCATGGAAAAGGCCCCTGAAGGAGTGCACCTCATCTGCTACTCCCAGGGGGGCCTGGTGTG
C
CGTGCTTTGCTGTCTGTCATGGATAACCACAATGTGGACTCTTTCATCTCCCTCTCCTCCCCACAGATG
GGC
CAGTATGGAGACACGGACTATTTGAAATGGCTCTTCCCCACGTCCATGCGGTCTAACCTCTATCGGG
TC
TGCTATAGTCCTTGGGGCCAGGAATTTTCCATTTGCAACTACTGGCACGATCCTCACCACGATGACTT
G
TACCTCAATGCCAGCAGCTTTCTGGCCCTCATCAATGGGGAAAGAGACCATCCCAATGCCACTGCATGG
CGG
AAGAACTTCCTTCGCGTGGGCCGTCTGGTGCTGATTGGGGGTCCTGATGATGGCGTTATCACTCCCT
GG
CAATCTAGCTTCTTTGGTTTCTATGATGCCAATGAGACAGTTCTGGAGATGGAGGAGCAGCCGGTGTA
T
CTTCGAGATTCTTTTGGGTTGAAGACTCTCCTGGCCCGGGGGGCCATAGTGAGGTGTCCCATGGCTGGC
ATC
TCTCACACCACGTGGCACTCTAACCGTACGCTCTACGATACTTGCATTGAGCCGTGGCTCTCCTGA


Translation (302 aa):
MPGLWRQRLPSAWALLLLPFLPLLMPAAPAAHRGSYKPVIVVHGLFDSSYSFRHLLDYINETHTGTVVTV
L
DLFDGRESLRPLWEQVQGFREAVVPIMEKAPEGVHLICYSQ
GGLVCRALLSVMDNHNVDSFISLSSPQM
G
QYG
DTDYLKWLFPTSMRSNLYRVCYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATAW
R
KNFLRVGRLVLIGGPDDGVITPWQS
SFFGFYDANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAG
I
SHTTWHSNRTLYDTCIEPWLS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser