NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25439.1 Public Mus musculus 11 Stat5a 21 106 86 CCDS HistoryNCBI Gene:20850Re-query CCDS DB by CCDS ID:25439.1Re-query CCDS DB by GeneID:20850See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004145 ENSMUSP00000004145 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004145Link to Ensembl Protein Viewer:ENSMUSP00000004145Re-query CCDS DB by Nucleotide ID:ENSMUST00000004145Re-query CCDS DB by Protein ID:ENSMUSP00000004145
Original member Current member EBI,WTSI ENSMUST00000107356 ENSMUSP00000102979 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107356Link to Ensembl Protein Viewer:ENSMUSP00000102979Re-query CCDS DB by Nucleotide ID:ENSMUST00000107356Re-query CCDS DB by Protein ID:ENSMUSP00000102979
Original member Current member EBI,WTSI OTTMUST00000004310 OTTMUSP00000002045 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000004310Link to Vega Protein Viewer:OTTMUSP00000002045Re-query CCDS DB by Nucleotide ID:OTTMUST00000004310Re-query CCDS DB by Protein ID:OTTMUSP00000002045
Original member Current member EBI,WTSI OTTMUST00000004311 OTTMUSP00000002046 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000004311Link to Vega Protein Viewer:OTTMUSP00000002046Re-query CCDS DB by Nucleotide ID:OTTMUST00000004311Re-query CCDS DB by Protein ID:OTTMUSP00000002046
Original member Current member NCBI NM_011488.3 NP_035618.1 Accepted alive Link to Nucleotide Sequence:NM_011488.3Link to Protein Sequence:NP_035618.1Re-query CCDS DB by Nucleotide ID:NM_011488Re-query CCDS DB by Protein ID:NP_035618Link to BLink:NP_035618.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035618.1 793 P42230 793 100% 0 0

Chromosomal Locations for CCDS 25439.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 100861338 100861465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100861721 100861877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100863131 100863220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100865331 100865505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100874003 100874133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100874339 100874490 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100874923 100875078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100875483 100875662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100876777 100876864 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100876942 100877064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100879279 100879371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100879611 100879817 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100880277 100880371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100880468 100880598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100881030 100881185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100881738 100881789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100882062 100882166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100883834 100883996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2382 nt):
ATGGCGGGCTGGATTCAGGCCCAGCAGCTTCAGGGAGATGCCCTGCGCCAGATGCAAGTGTTGTATGGGC
AG
CATTTCCCCATCGAGGTCCGGCACTACCTGGCCCAGTGGATCGAGAGCCAGCCGTGGGATGCTATTGA
C
TTGGATAATCCCCAGGACCGAGGTCAGGCCACCCAACTCCTGGAGGGCCTGGTGCAGGAGCTGCAGAAG
AAG
GCGGAGCACCAGGTGGGGGAAGATGGGTTTTTGCTGAAGATCAAGCTGGGGCACTATGCCACACAGC
TC
CAGAACACGTATGACCGCTGTCCCATGGAGCTGGTTCGCTGTATCCGTCACATTCTGTACAACGAACA
G
AGGCTGGTTCGCGAAGCCAACAATTGCAGCTCCCCTGCTGGTGTCCTGGTTGACGCCATGTCCCAGAAG
CAC
CTTCAGATCAACCAAAGGTTTGAGGAGCTGCGCCTGATCACACAGGACACGGAGAACGAGCTGAAGA
AG
CTGCAGCAGACCCAAGAGTACTTCATCATCCAGTACCAGGAGAGCCTGCGGATCCAAGCTCAGTTTGC
C
CAGCTGGGCCAGCTGAACCCCCAGGAGCGCATGAGCAGGGAGACGGCCCTCCAGCAGAAGCAAGTGTCC
CTG
GAGACCTGGCTGCAGCGAGAGGCACAGACACTGCAGCAGTACCGAGTGGAGCTGGCTGAGAAGCACC
AG
AAGACCCTGCAGCTGCTGCGGAAGCAGCAGACCATCATCCTGGACGACGAGCTGATCCAGTGGAAGCG
G
AGACAGCAGCTGGCCGGGAACGGGGGTCCCCCCGAGGGCAGCCTGGACGTGCTGCAGTCCTGGTGTGAG
AAG
CTGGCCGAGATCATCTGGCAGAACCGGCAGCAGATCCGCAGGGCTGAGCACCTGTGCCAGCAGCTGC
CC
ATCCCAGGCCCCGTGGAGGAGATGCTGGCTGAGGTCAACGCCACCATCACGGACATCATCTCAGCTCT
G
GTCACCAGCACGTTCATCATCGAGAAGCAGCCTCCTCAGGTCCTGAAGACCCAGACCAAGTTTGCGGCC
ACC
GTGCGCCTGCTGGTGGGGGGAAAGCTGAATGTGCACATGAACCCCCCGCAGGTGAAGGCGACCATCA
TC
AGCGAGCAGCAGGCCAAGTCCCTGCTCAAGAATGAGAACACCCGCAATGAGTGCAGCGGCGAGATCCT
G
AACAACTGTTGCGTCATGGAGTACCACCAGGCCACTGGCACGCTCAGCGCCCACTTCAGAAACATGTCA
CTG
AAAAGAATCAAGCGCGCCGACAGGCGTGGTGCAGAGTCGGTGACGGAGGAGAAGTTCACAGTCCTGT
TT
GAGTCTCAGTTCAGCGTTGGCAGCAACGAGCTGGTGTTCCAGGTGAAGACCCTGTCCCTCCCTGTGGT
C
GTTATCGTCCATGGCAGCCAGGACCACAATGCTACTGCCACCGTGCTGTGGGACAATGCCTTTGCTGAG
CCG
GGCAGGGTGCCATTTGCTGTGCCTGACAAGGTGCTGTGGCCGCAGCTGTGTGAAGCGCTCAACATGA
AA
TTCAAGGCTGAAGTACAGAGCAACCGGGGCTTGACCAAAGAGAACCTCGTGTTCCTGGCACAGAAACT
G
TTCAACATCAGCAGCAACCACCTCGAGGACTACAACAGCATGTCTGTGTCCTGGTCCCAGTTCAACCGG
GAG
AACTTGCCCGGCTGGAACTACACCTTCTGGCAGTGGTTCGACGGGGTGATGGAGGTGCTGAAGAAGC
AC
CATAAGCCCCATTGGAATGATGGGGCTATCCTGGGTTTCGTGAACAAGCAACAGGCCCACGACCTGCT
C
ATCAACAAGCCGGACGGGACCTTCCTGCTGCGCTTCAGTGACTCGGAAATCGGGGGCATCACCATTGCT
TGG
AAGTTTGACTCTCCGGACCGAAACCTCTGGAATCTGAAGCCATTCACGACGCGAGATTTCTCCATTC
GG
TCCCTGGCCGACCGGCTGGGGGACCTGAACTACCTTATCTACGTGTTCCCAGACCGACCCAAGGACGA
G
GTCTTTGCCAAGTATTACACTCCTGTACTTGCGAAAGCAGTTGACGGATACGTGAAGCCACAGATCAAG
CAA
GTGGTCCCTGAGTTCGTCAATGCATCCACAGATGCCGGAGCCAGCGCCACCTACATGGACCAGGCTC
CT
TCCCCAGTCGTGTGCCCTCAACCTCACTACAACATGTACCCACCCAACCCTGACCCTGTCCTTGACCA
A
GATGGCGAGTTTGACCTGGATGAGAGCATGGATGTTGCCAGGCACGTGGAAGAACTTTTACGCCGGCCC
ATG
GACAGTCTCGACGCCCGCCTCTCCCCACCTGCTGGTCTCTTCACCTCCGCTAGAAGCTCCCTGTCCT
GA


Translation (793 aa):
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQLLEGLVQELQK
K
AEHQVGEDGFLLKIKLGHYATQLQ
NTYDRCPMELVRCIRHILYNEQRLVREANNCSSPAGVLVDAMSQK
H
LQINQRFEELRLITQDTENELKKLQQTQEYFIIQYQESLRIQ
AQFAQLGQLNPQERMSRETALQQKQVS
L
ETWLQREAQTLQQYRV
ELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE
K
LAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVT
STFIIEKQPPQVLKTQTKFAA
T
VRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTR
NECSGEILNNCCVMEYHQATGTLSAHFRNMS
L
KRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVK
TLSLPVVVIVHGSQDHNATATVLWDNAFAE
P
GRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNR
E
NLPGWNYTFWQWFDGVMEVLKKHHKPHWND
GAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA
W
KFDS
PDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIK
Q
VVP
EFVNASTDAGASATYMDQAPSPVVCPQPHYNMYPPNPDPVLDQDGEFDLDESMDVARHVEELLRRP
M
DSLDARLSPPAGLFTSARSSLS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser