NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2412.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2412.1 Public Homo sapiens 2 TMBIM1 20 108 85 CCDS HistoryNCBI Gene:64114Re-query CCDS DB by CCDS ID:2412.1Re-query CCDS DB by GeneID:64114See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2412.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000258412 ENSP00000258412 Accepted alive Link to Ensembl Transcript Viewer:ENST00000258412Link to Ensembl Protein Viewer:ENSP00000258412Re-query CCDS DB by Nucleotide ID:ENST00000258412Re-query CCDS DB by Protein ID:ENSP00000258412
Original member Current member EBI,WTSI ENST00000396809 ENSP00000380025 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396809Link to Ensembl Protein Viewer:ENSP00000380025Re-query CCDS DB by Nucleotide ID:ENST00000396809Re-query CCDS DB by Protein ID:ENSP00000380025
Original member Current member EBI,WTSI ENST00000444881 ENSP00000409738 Accepted alive Link to Ensembl Transcript Viewer:ENST00000444881Link to Ensembl Protein Viewer:ENSP00000409738Re-query CCDS DB by Nucleotide ID:ENST00000444881Re-query CCDS DB by Protein ID:ENSP00000409738
Original member Current member EBI,WTSI OTTHUMT00000256770 OTTHUMP00000164137 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000256770Link to Vega Protein Viewer:OTTHUMP00000164137Re-query CCDS DB by Nucleotide ID:OTTHUMT00000256770Re-query CCDS DB by Protein ID:OTTHUMP00000164137
Original member Current member EBI,WTSI OTTHUMT00000338559 OTTHUMP00000207318 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000338559Link to Vega Protein Viewer:OTTHUMP00000207318Re-query CCDS DB by Nucleotide ID:OTTHUMT00000338559Re-query CCDS DB by Protein ID:OTTHUMP00000207318
Original member Current member NCBI NM_001321427.1 NP_001308356.1 Accepted alive Link to Nucleotide Sequence:NM_001321427.1Link to Protein Sequence:NP_001308356.1Re-query CCDS DB by Nucleotide ID:NM_001321427Re-query CCDS DB by Protein ID:NP_001308356Link to BLink:NP_001308356.1
Original member Current member NCBI NM_001321428.1 NP_001308357.1 Accepted alive Link to Nucleotide Sequence:NM_001321428.1Link to Protein Sequence:NP_001308357.1Re-query CCDS DB by Nucleotide ID:NM_001321428Re-query CCDS DB by Protein ID:NP_001308357Link to BLink:NP_001308357.1
Original member Current member NCBI NM_001321429.1 NP_001308358.1 Accepted alive Link to Nucleotide Sequence:NM_001321429.1Link to Protein Sequence:NP_001308358.1Re-query CCDS DB by Nucleotide ID:NM_001321429Re-query CCDS DB by Protein ID:NP_001308358Link to BLink:NP_001308358.1
Original member Current member NCBI NM_001321430.1 NP_001308359.1 Accepted alive Link to Nucleotide Sequence:NM_001321430.1Link to Protein Sequence:NP_001308359.1Re-query CCDS DB by Nucleotide ID:NM_001321430Re-query CCDS DB by Protein ID:NP_001308359Link to BLink:NP_001308359.1
Original member Current member NCBI NM_001321432.1 NP_001308361.1 Accepted alive Link to Nucleotide Sequence:NM_001321432.1Link to Protein Sequence:NP_001308361.1Re-query CCDS DB by Nucleotide ID:NM_001321432Re-query CCDS DB by Protein ID:NP_001308361Link to BLink:NP_001308361.1
Original member Current member NCBI NM_001321433.1 NP_001308362.1 Accepted alive Link to Nucleotide Sequence:NM_001321433.1Link to Protein Sequence:NP_001308362.1Re-query CCDS DB by Nucleotide ID:NM_001321433Re-query CCDS DB by Protein ID:NP_001308362Link to BLink:NP_001308362.1
Original member Current member NCBI NM_001321435.1 NP_001308364.1 Accepted alive Link to Nucleotide Sequence:NM_001321435.1Link to Protein Sequence:NP_001308364.1Re-query CCDS DB by Nucleotide ID:NM_001321435Re-query CCDS DB by Protein ID:NP_001308364Link to BLink:NP_001308364.1
Original member Current member NCBI NM_001321436.1 NP_001308365.1 Accepted alive Link to Nucleotide Sequence:NM_001321436.1Link to Protein Sequence:NP_001308365.1Re-query CCDS DB by Nucleotide ID:NM_001321436Re-query CCDS DB by Protein ID:NP_001308365Link to BLink:NP_001308365.1
Original member Current member NCBI NM_022152.5 NP_071435.2 Accepted alive Link to Nucleotide Sequence:NM_022152.5Link to Protein Sequence:NP_071435.2Re-query CCDS DB by Nucleotide ID:NM_022152Re-query CCDS DB by Protein ID:NP_071435Link to BLink:NP_071435.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001308356.1 311 Q969X1 311 100% 0 0
NP_001308357.1 311 Q969X1 311 100% 0 0
NP_001308358.1 311 Q969X1 311 100% 0 0
NP_001308359.1 311 Q969X1 311 100% 0 0
NP_001308361.1 311 Q969X1 311 100% 0 0
NP_001308362.1 311 Q969X1 311 100% 0 0
NP_001308364.1 311 Q969X1 311 100% 0 0
NP_001308365.1 311 Q969X1 311 100% 0 0
NP_071435.2 311 Q969X1 311 100% 0 0

Chromosomal Locations for CCDS 2412.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 218275475 218275621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218276026 218276079 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218277004 218277099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218277366 218277453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218277633 218277670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218277935 218277974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218278515 218278565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218279038 218279091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218279289 218279353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218280026 218280126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 218281940 218282141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGTCCAACCCCAGCGCCCCACCACCATATGAAGACCGCAACCCCCTGTACCCAGGCCCTCCGCCCCCTG
GG
GGCTATGGGCAGCCATCTGTCCTGCCAGGAGGGTATCCTGCCTACCCTGGCTACCCGCAGCCTGGCTA
C
GGTCACCCTGCTGGCTACCCACAGCCCATGCCCCCCACCCACCCGATGCCCATGAACTACGGCCCAGGC
CAT
GGCTATGATGGGGAGGAGAGAGCAGTGAGTGATAGCTTCGGGCCTGGAGAGTGGGATGACCGGAAAG
TG
CGACACACTTTTATCCGAAAGGTTTACTCCATCATCTCCGTGCAGCTGCTCATCACTGTGGCCATCAT
T
GCTATCTTCACCTTTGTGGAACCTGTCAGCGCCTTTGTGAGGAGAAATGTGGCTGTCTACTACGTGTCC
TA
T
GCTGTCTTCGTTGTCACCTACCTGATCCTTGCCTGCTGCCAGGGACCCAGACGCCGTTTCCCATGGA
AC
ATCATTCTGCTGACCCTTTTTACTTTTGCCATGGGCTTCATGACGGGCACCATTTCCAGTATGTACCA
A
ACCAAAGCCGTCATCATTGCAATGATCATCACTGCGGTGGTATCCATTTCAGTCACCATCTTCTGCTTT
CAG
ACCAAGGTGGACTTCACCTCGTGCACAGGCCTCTTCTGTGTCCTGGGAATTGTGCTCCTGGTGACTG
GG
ATTGTCACTAGCATTGTGCTCTACTTCCAATACGTTTACTGGCTCCACATGCTCTATGCTGCTCTGGG
G
GCCATTTGTTTCACCCTGTTCCTGGCTTACGACACACAGCTGGTCCTGGGGAACCGGAAGCACACCATC
AGC
CCCGAGGACTACATCACTGGCGCCCTGCAGATTTACACAGACATCATCTACATCTTCACCTTTGTGC
TG
CAGCTGATGGGGGATCGCAATTAA


Translation (311 aa):
MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPG
H
GYDGEERAVSDSFGPGEWDDRKVRHTFIRK
VYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVS
Y
AVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCF
Q
TK
VDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI
S
PEDYITGALQIYTDIIYIFTFVLQLMGDRN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser