NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS13418.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13418.1 Public Homo sapiens 20 KCNB1 22 109 92 CCDS HistoryNCBI Gene:3745Re-query CCDS DB by CCDS ID:13418.1Re-query CCDS DB by GeneID:3745See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13418.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000371741.5 ENSP00000360806.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000371741.5Link to Ensembl Protein Viewer:ENSP00000360806.3Re-query CCDS DB by Nucleotide ID:ENST00000371741Re-query CCDS DB by Protein ID:ENSP00000360806
Original member Current member EBI,WTSI ENST00000635465.1 ENSP00000489193.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000635465.1Link to Ensembl Protein Viewer:ENSP00000489193.1Re-query CCDS DB by Nucleotide ID:ENST00000635465Re-query CCDS DB by Protein ID:ENSP00000489193
Original member NCBI NM_004975.3 NP_004966.1 Updated not alive Link to Nucleotide Sequence:NM_004975.3Link to Protein Sequence:NP_004966.1Re-query CCDS DB by Nucleotide ID:NM_004975Re-query CCDS DB by Protein ID:NP_004966
Current member NCBI NM_004975.4 NP_004966.1 Accepted alive Link to Nucleotide Sequence:NM_004975.4Link to Protein Sequence:NP_004966.1Re-query CCDS DB by Nucleotide ID:NM_004975Re-query CCDS DB by Protein ID:NP_004966Link to BLAST:NP_004966.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004966.1 858 Q14721 858 100% 0 0

Chromosomal Locations for CCDS 13418.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 49372983 49374992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 49481914 49482480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2577 nt):
ATGCCGGCGGGCATGACGAAGCATGGCTCCCGCTCCACCAGCTCGCTGCCGCCCGAGCCCATGGAGATCG
TG
CGCAGCAAGGCGTGCTCTCGGCGGGTCCGCCTCAACGTCGGGGGGCTGGCGCACGAGGTACTCTGGCG
T
ACCCTGGACCGCCTGCCCCGCACGCGGCTGGGCAAGCTCCGCGACTGCAACACGCACGACTCGCTGCTC
GAG
GTGTGCGATGACTACAGCCTCGACGACAACGAGTACTTCTTTGACCGCCACCCGGGCGCCTTCACCT
CC
ATCCTCAACTTCTACCGCACTGGGCGACTGCACATGATGGAGGAGATGTGCGCGCTCAGCTTCAGCCA
A
GAGCTCGACTACTGGGGCATCGACGAGATCTACCTGGAGTCCTGCTGCCAGGCCCGCTACCACCAGAAG
AAA
GAGCAGATGAACGAGGAGCTCAAGCGTGAGGCCGAGACCCTACGGGAGCGGGAAGGCGAGGAGTTCG
AT
AACACGTGCTGCGCAGAGAAGAGGAAAAAACTCTGGGACCTACTGGAGAAGCCCAATTCCTCTGTGGC
T
GCCAAGATCCTTGCCATAATTTCCATCATGTTCATCGTCCTCTCCACCATTGCCCTGTCCCTCAACACG
CTG
CCTGAGCTACAGAGCCTCGATGAGTTCGGCCAGTCCACAGACAACCCCCAGCTGGCCCACGTGGAGG
CC
GTGTGCATCGCATGGTTCACCATGGAGTACCTGCTGAGGTTCCTCTCCTCGCCCAAGAAGTGGAAGTT
C
TTCAAGGGCCCACTCAATGCCATTGACTTGTTGGCCATTCTGCCATACTATGTCACCATTTTCCTCACC
GAA
TCCAACAAGAGCGTGCTGCAATTCCAGAATGTCCGCCGCGTGGTCCAGATCTTCCGCATCATGCGAA
TT
CTCCGCATCCTTAAGCTTGCACGCCACTCCACTGGCCTCCAGTCTCTGGGCTTCACTTTGCGGAGGAG
C
TACAATGAGTTGGGCTTGCTCATCCTCTTCCTTGCCATGGGCATTATGATCTTCTCCAGCCTTGTCTTC
TTT
GCTGAGAAGGATGAGGACGACACCAAGTTCAAAAGCATCCCAGCCTCTTTCTGGTGGGCCACCATCA
CC
ATGACTACTGTTGGGTATGGAGACATCTACCCCAAGACTCTCCTGGGGAAAATTGTTGGGGGACTCTG
C
TGCATTGCAGGAGTCCTGGTGATTGCTCTTCCCATCCCCATCATCGTCAATAACTTCTCTGAGTTCTAT
AAG
GAGCAGAAGAGACAGGAGAAAGCAATCAAACGGCGAGAGGCTCTGGAGAGAGCCAAGAGGAATGGCA
GC
ATCGTATCCATGAACATGAAGGATGCTTTTGCCCGGAGCATTGAGATGATGGACATTGTGGTTGAGAA
A
AATGGGGAGAATATGGGTAAGAAAGACAAAGTACAAGATAACCACTTGTCTCCTAACAAATGGAAATGG
ACA
AAGAGGACACTGTCTGAAACCAGCTCAAGTAAGTCCTTTGAAACCAAGGAACAGGGATCCCCTGAAA
AA
GCCAGATCGTCTTCTAGTCCTCAGCACCTGAACGTTCAGCAGTTGGAAGACATGTACAATAAGATGGC
C
AAGACCCAATCCCAACCCATCCTCAATACCAAGGAGTCAGCAGCACAGAGCAAACCAAAGGAAGAACTT
GAA
ATGGAGAGTATCCCCAGCCCCGTAGCCCCTCTGCCCACTCGCACAGAAGGGGTCATTGACATGCGAA
GT
ATGTCAAGCATTGATAGTTTCATTAGCTGTGCCACAGACTTCCCTGAGGCCACCAGATTCTCCCACAG
C
CCTTTGACATCACTCCCCAGCAAGACTGGGGGCAGCACAGCCCCAGAAGTGGGCTGGCGGGGAGCTCTG
GGT
GCCAGTGGTGGTAGGTTTGTGGAGGCCAACCCCAGCCCTGATGCCAGCCAGCACTCTAGTTTCTTCA
TC
GAGAGCCCCAAGAGTTCCATGAAAACTAACAACCCTTTGAAGCTCCGAGCACTTAAAGTCAACTTCAT
G
GAGGGTGACCCCAGTCCACTCCTCCCCGTTCTAGGGATGTACCATGACCCTCTCAGGAACCGGGGGAGT
GCT
GCGGCTGCTGTCGCTGGACTGGAGTGTGCCACGCTTTTGGACAAGGCTGTGCTGAGCCCAGAGTCCT
CC
ATCTACACCACAGCAAGTGCTAAGACACCCCCCCGGTCTCCTGAGAAACACACAGCAATAGCGTTCAA
C
TTTGAGGCGGGTGTCCACCAGTACATTGACGCAGACACAGATGATGAGGGACAGCTGCTCTACAGTGTG
GAC
TCCAGCCCCCCCAAAAGCCTCCCTGGGAGCACCAGTCCGAAGTTCAGCACGGGGACAAGATCGGAGA
AA
AACCACTTTGAAAGCTCCCCTTTACCCACCTCCCCTAAGTTCTTAAGGCAGAACTGTATTTACTCCAC
A
GAAGCATTGACTGGAAAAGGCCCCAGTGGTCAGGAAAAGTGCAAACTTGAGAACCACATCTCCCCTGAC
GTC
CGTGTGTTGCCAGGGGGAGGAGCCCATGGAAGCACACGAGATCAGAGCATCTGA


Translation (858 aa):
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLL
E
VCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQK
K
EQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAK
ILAIISIMFIVLSTIALSLNT
L
PELQSLDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLT
E
SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVF
F
AEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
K
EQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGENMGKKDKVQDNHLSPNKWKW
T
KRTLSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILNTKESAAQSKPKEEL
E
MESIPSPVAPLPTRTEGVIDMRSMSSIDSFISCATDFPEATRFSHSPLTSLPSKTGGSTAPEVGWRGAL
G
ASGGRFVEANPSPDASQHSSFFIESPKSSMKTNNPLKLRALKVNFMEGDPSPLLPVLGMYHDPLRNRGS
A
AAAVAGLECATLLDKAVLSPESSIYTTASAKTPPRSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSV
D
SSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGKGPSGQEKCKLENHISPD
V
RVLPGGGAHGSTRDQSI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser