NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13112.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13112.1 Public Homo sapiens 20 JAG1 20 108 85 CCDS HistoryNCBI Gene:182Re-query CCDS DB by CCDS ID:13112.1Re-query CCDS DB by GeneID:182See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13112.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000254958 ENSP00000254958 Accepted alive Link to Ensembl Transcript Viewer:ENST00000254958Link to Ensembl Protein Viewer:ENSP00000254958Re-query CCDS DB by Nucleotide ID:ENST00000254958Re-query CCDS DB by Protein ID:ENSP00000254958
Original member Current member EBI,WTSI OTTHUMT00000077998 OTTHUMP00000274627 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000077998Link to Vega Protein Viewer:OTTHUMP00000274627Re-query CCDS DB by Nucleotide ID:OTTHUMT00000077998Re-query CCDS DB by Protein ID:OTTHUMP00000274627
Original member Current member NCBI NM_000214.2 NP_000205.1 Accepted alive Link to Nucleotide Sequence:NM_000214.2Link to Protein Sequence:NP_000205.1Re-query CCDS DB by Nucleotide ID:NM_000214Re-query CCDS DB by Protein ID:NP_000205Link to BLink:NP_000205.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000205.1 1218 P78504-1 1218 100% 0 0

Chromosomal Locations for CCDS 13112.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 20Link to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 10639498 10639955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10640783 10640933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10641113 10641244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10641460 10641693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10641783 10641892 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10642488 10642601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10643778 10643863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10644357 10644384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10644863 10644979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10645143 10645256 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10645356 10645469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10645971 10646084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10646939 10647103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10647960 10648110 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10648549 10648722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10649061 10649107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10649522 10649635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10650247 10650360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10651581 10651694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10652131 10652250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10652468 10652598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10656398 10656458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10658468 10658722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10663963 10664014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10672701 10673006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 10673450 10673530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3657 nt):
ATGCGTTCCCCACGGACGCGCGGCCGGTCCGGGCGCCCCCTAAGCCTCCTGCTCGCCCTGCTCTGTGCCC
TG
CGAGCCAAGGTGTGTGGGGCCTCGGGTCAGTTCGAGTTGGAGATCCTGTCCATGCAGAACGTGAACGG
G
GAGCTGCAGAACGGGAACTGCTGCGGCGGCGCCCGGAACCCGGGAGACCGCAAGTGCACCCGCGACGAG
TGT
GACACATACTTCAAAGTGTGCCTCAAGGAGTATCAGTCCCGCGTCACGGCCGGGGGGCCCTGCAGCT
TC
GGCTCAGGGTCCACGCCTGTCATCGGGGGCAACACCTTCAACCTCAAGGCCAGCCGCGGCAACGACCG
C
AACCGCATCGTGCTGCCTTTCAGTTTCGCCTGGCCGAGGTCCTATACGTTGCTTGTGGAGGCGTGGGAT
TCC
AGTAATGACACCGTTCAACCTGACAGTATTATTGAAAAGGCTTCTCACTCGGGCATGATCAACCCCA
GC
CGGCAGTGGCAGACGCTGAAGCAGAACACGGGCGTTGCCCACTTTGAGTATCAGATCCGCGTGACCTG
T
GATGACTACTACTATGGCTTTGGCTGCAATAAGTTCTGCCGCCCCAGAGATGACTTCTTTGGACACTAT
GCC
TGTGACCAGAATGGCAACAAAACTTGCATGGAAGGCTGGATGGGCCCCGAATGTAACAGAGCTATTT
GC
CGACAAGGCTGCAGTCCTAAGCATGGGTCTTGCAAACTCCCAGGTGACTGCAGGTGCCAGTACGGCTG
G
CAAGGCCTGTACTGTGATAAGTGCATCCCACACCCGGGATGCGTCCACGGCATCTGTAATGAGCCCTGG
CAG
TGCCTCTGTGAGACCAACTGGGGCGGCCAGCTCTGTGACAAAGATCTCAATTACTGTGGGACTCATC
AG
CCGTGTCTCAACGGGGGAACTTGTAGCAACACAGGCCCTGACAAATATCAGTGTTCCTGCCCTGAGGG
G
TATTCAGGACCCAACTGTGAAATTGCTGAGCACGCCTGCCTCTCTGATCCCTGTCACAACAGAGGCAGC
TGT
AAGGAGACCTCCCTGGGCTTTGAGTGTGAGTGTTCCCCAGGCTGGACCGGCCCCACATGCTCTACAA
AC
ATTGATGACTGTTCTCCTAATAACTGTTCCCACGGGGGCACCTGCCAGGACCTGGTTAACGGATTTAA
G
TGTGTGTGCCCCCCACAGTGGACTGGGAAAACGTGCCAGTTAGATGCAAATGAATGTGAGGCCAAACCT
TGT
GTAAACGCCAAATCCTGTAAGAATCTCATTGCCAGCTACTACTGCGACTGTCTTCCCGGCTGGATGG
GT
CAGAATTGTGACATAAATATTAATGACTGCCTTGGCCAGTGTCAGAATGACGCCTCCTGTCGGGATTT
G
GTTAATGGTTATCGCTGTATCTGTCCACCTGGCTATGCAGGCGATCACTGTGAGAGAGACATCGATGAA
TGT
GCCAGCAACCCCTGTTTGAATGGGGGTCACTGTCAGAATGAAATCAACAGATTCCAGTGTCTGTGTC
CC
ACTGGTTTCTCTGGAAACCTCTGTCAGCTGGACATCGATTATTGTGAGCCTAATCCCTGCCAGAACGG
T
GCCCAGTGCTACAACCGTGCCAGTGACTATTTCTGCAAGTGCCCCGAGGACTATGAGGGCAAGAACTGC
TCA
CACCTGAAAGACCACTGCCGCACGACCCCCTGTGAAGTGATTGACAGCTGCACAGTGGCCATGGCTT
CC
AACGACACACCTGAAGGGGTGCGGTATATTTCCTCCAACGTCTGTGGTCCTCACGGGAAGTGCAAGAG
T
CAGTCGGGAGGCAAATTCACCTGTGACTGTAACAAAGGCTTCACGGGAACATACTGCCATGAAAATATT
AAT
GACTGTGAGAGCAACCCTTGTAGAAACGGTGGCACTTGCATCGATGGTGTCAACTCCTACAAGTGCA
TC
TGTAGTGACGGCTGGGAGGGGGCCTACTGTGAAACCAATATTAATGACTGCAGCCAGAACCCCTGCCA
C
AATGGGGGCACGTGTCGCGACCTGGTCAATGACTTCTACTGTGACTGTAAAAATGGGTGGAAAGGAAAG
ACC
TGCCACTCACGTGACAGTCAGTGTGATGAGGCCACGTGCAACAACGGTGGCACCTGCTATGATGAGG
GG
GATGCTTTTAAGTGCATGTGTCCTGGCGGCTGGGAAGGAACAACCTGTAACATAGCCCGAAACAGTAG
C
TGCCTGCCCAACCCCTGCCATAATGGGGGCACATGTGTGGTCAACGGCGAGTCCTTTACGTGCGTCTGC
AAG
GAAGGCTGGGAGGGGCCCATCTGTGCTCAGAATACCAATGACTGCAGCCCTCATCCCTGTTACAACA
GC
GGCACCTGTGTGGATGGAGACAACTGGTACCGGTGCGAATGTGCCCCGGGTTTTGCTGGGCCCGACTG
C
AGAATAAACATCAATGAATGCCAGTCTTCACCTTGTGCCTTTGGAGCGACCTGTGTGGATGAGATCAAT
GGC
TACCGGTGTGTCTGCCCTCCAGGGCACAGTGGTGCCAAGTGCCAGGAAGTTTCAGGGAGACCTTGCA
TC
ACCATGGGGAGTGTGATACCAGATGGGGCCAAATGGGATGATGACTGTAATACCTGCCAGTGCCTGAA
T
GGACGGATCGCCTGCTCAAAGGTCTGGTGTGGCCCTCGACCTTGCCTGCTCCACAAAGGGCACAGCGAG
TGC
CCCAGCGGGCAGAGCTGCATCCCCATCCTGGACGACCAGTGCTTCGTCCACCCCTGCACTGGTGTGG
GC
GAGTGTCGGTCTTCCAGTCTCCAGCCGGTGAAGACAAAGTGCACCTCTGACTCCTATTACCAGGATAA
C
TGTGCGAACATCACATTTACCTTTAACAAGGAGATGATGTCACCAGGTCTTACTACGGAGCACATTTGC
AGT
GAATTGAGGAATTTGAATATTTTGAAGAATGTTTCCGCTGAATATTCAATCTACATCGCTTGCGAGC
CT
TCCCCTTCAGCGAACAATGAAATACATGTGGCCATTTCTGCTGAAGATATACGGGATGATGGGAACCC
G
ATCAAGGAAATCACTGACAAAATAATCGATCTTGTTAGTAAACGTGATGGAAACAGCTCGCTGATTGCT
GCC
GTTGCAGAAGTAAGAGTTCAGAGGCGGCCTCTGAAGAACAGAACAGATTTCCTTGTTCCCTTGCTGA
GC
TCTGTCTTAACTGTGGCTTGGATCTGTTGCTTGGTGACGGCCTTCTACTGGTGCCTGCGGAAGCGGCG
G
AAGCCGGGCAGCCACACACACTCAGCCTCTGAGGACAACACCACCAACAACGTGCGGGAGCAGCTGAAC
CAG
ATCAAAAACCCCATTGAGAAACATGGGGCCAACACGGTCCCCATCAAGGATTATGAGAACAAGAACT
CC
AAAATGTCTAAAATAAGGACACACAATTCTGAAGTAGAAGAGGACGACATGGACAAACACCAGCAGAA
A
GCCCGGTTTGCCAAGCAGCCGGCGTACACGCTGGTAGACAGAGAAGAGAAGCCCCCCAACGGCACGCCG
ACA
AAACACCCAAACTGGACAAACAAACAGGACAACAGAGACTTGGAAAGTGCCCAGAGCTTAAACCGAA
TG
GAGTACATCGTATAG


Translation (1218 aa):
MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDE
C
DTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWP
RSYTLLVEAWD
S
SNDTV
QPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHY
A
CDQNGNKTCMEGWMGPECNR
AICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPW
Q
CLCETNWGGQLCDK
DLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS
C
KETSLGFECECSPGWTGPTCST
NIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
C
VNAKSCKNLIASYYCDCLPGWMGQNCDI
NINDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDE
C
ASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQ
LDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNC
S
HLKDHCRTTPCE
VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENI
N
DCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCET
NINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGK
T
CHS
RDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVC
K
EGWEGPICAQ
NTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
G
YRCVCPPGHSGAKCQE
VSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSE
C
PSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSP
GLTTEHIC
S
ELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAI
SAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIA
A
VAEVRVQRRPLKNRT
DFLVPLLSSVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLN
Q
IKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTP
T
KHPNWTNKQDNRDLESAQSLNRMEYIV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser