NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12987.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12987.1 Public Homo sapiens 19 UBE2M 20 108 85 CCDS HistoryNCBI Gene:9040Re-query CCDS DB by CCDS ID:12987.1Re-query CCDS DB by GeneID:9040See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12987.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000253023 ENSP00000253023 Accepted alive Link to Ensembl Transcript Viewer:ENST00000253023Link to Ensembl Protein Viewer:ENSP00000253023Re-query CCDS DB by Nucleotide ID:ENST00000253023Re-query CCDS DB by Protein ID:ENSP00000253023
Original member Current member EBI,WTSI OTTHUMT00000467097 OTTHUMP00000271949 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000467097Link to Vega Protein Viewer:OTTHUMP00000271949Re-query CCDS DB by Nucleotide ID:OTTHUMT00000467097Re-query CCDS DB by Protein ID:OTTHUMP00000271949
Original member Current member NCBI NM_003969.3 NP_003960.1 Accepted alive Link to Nucleotide Sequence:NM_003969.3Link to Protein Sequence:NP_003960.1Re-query CCDS DB by Nucleotide ID:NM_003969Re-query CCDS DB by Protein ID:NP_003960Link to BLAST:NP_003960.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003960.1 183 P61081 183 100% 0 0

Chromosomal Locations for CCDS 12987.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 58556089 58556229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 58556316 58556379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 58556687 58556790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 58556892 58556930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 58557063 58557157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 58558273 58558381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (552 nt):
ATGATCAAGCTGTTCTCGCTGAAGCAGCAGAAGAAGGAGGAGGAGTCGGCGGGCGGCACCAAGGGCAGCA
GC
AAGAAGGCGTCGGCGGCGCAGCTGCGGATCCAGAAGGACATAAACGAGCTGAACCTGCCCAAGACGTG
T
GATATCAGCTTCTCAGATCCAGACGACCTCCTCAACTTCAAGCTGGTCATCTGTCCTGATGAGGGCTTC
TAC
AAGAGTGGGAAGTTTGTGTTCAGTTTTAAGGTGGGCCAGGGTTACCCGCATGATCCCCCCAAGGTGA
AG
TGTGAGACAATGGTCTATCACCCCAACATTGACCTCGAGGGCAACGTCTGCCTCAACATCCTCAGAGA
G
GACTGGAAGCCAGTCCTTACGATAAACTCCATAATTTATGGCCTGCAGTATCTCTTCTTGGAGCCCAAC
CCC
GAGGACCCACTGAACAAGGAGGCCGCAGAGGTCCTGCAGAACAACCGGCGGCTGTTTGAGCAGAACG
TG
CAGCGCTCCATGCGGGGTGGCTACATCGGCTCCACCTACTTTGAGCGCTGCCTGAAATAG


Translation (183 aa):
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGF
Y
KSGKFVFSFK
VGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPN
P
EDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser